diff --git a/go.mod b/go.mod index 7baf9b1a2..2eb62c80d 100644 --- a/go.mod +++ b/go.mod @@ -43,7 +43,7 @@ require ( github.com/jackc/pgx/v5 v5.6.0 github.com/microcosm-cc/bluemonday v1.0.27 github.com/miekg/dns v1.1.61 - github.com/minio/minio-go/v7 v7.0.72 + github.com/minio/minio-go/v7 v7.0.73 github.com/mitchellh/mapstructure v1.5.0 github.com/ncruces/go-sqlite3 v0.17.0 github.com/oklog/ulid v1.3.1 @@ -119,6 +119,7 @@ require ( github.com/gin-contrib/sse v0.1.0 // indirect github.com/go-errors/errors v1.4.1 // indirect github.com/go-fed/httpsig v1.1.0 // indirect + github.com/go-ini/ini v1.67.0 // indirect github.com/go-jose/go-jose/v4 v4.0.1 // indirect github.com/go-logr/logr v1.4.1 // indirect github.com/go-logr/stdr v1.2.2 // indirect @@ -137,7 +138,7 @@ require ( github.com/go-playground/universal-translator v0.18.1 // indirect github.com/go-playground/validator/v10 v10.20.0 // indirect github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850 // indirect - github.com/goccy/go-json v0.10.2 // indirect + github.com/goccy/go-json v0.10.3 // indirect github.com/godbus/dbus/v5 v5.0.4 // indirect github.com/golang-jwt/jwt v3.2.2+incompatible // indirect github.com/golang/geo v0.0.0-20210211234256-740aa86cb551 // indirect @@ -159,8 +160,8 @@ require ( github.com/jinzhu/inflection v1.0.0 // indirect github.com/josharian/intern v1.0.0 // indirect github.com/json-iterator/go v1.1.12 // indirect - github.com/klauspost/compress v1.17.8 // indirect - github.com/klauspost/cpuid/v2 v2.2.7 // indirect + github.com/klauspost/compress v1.17.9 // indirect + github.com/klauspost/cpuid/v2 v2.2.8 // indirect github.com/kr/pretty v0.3.1 // indirect github.com/kr/text v0.2.0 // indirect github.com/leodido/go-urn v1.4.0 // indirect diff --git a/go.sum b/go.sum index 7c3a7c906..96fa75ee8 100644 --- a/go.sum +++ b/go.sum @@ -207,6 +207,8 @@ github.com/go-fed/httpsig v1.1.0/go.mod h1:RCMrTZvN1bJYtofsG4rd5NaO5obxQ5xBkdiS7 github.com/go-gl/glfw v0.0.0-20190409004039-e6da0acd62b1/go.mod h1:vR7hzQXu2zJy9AVAgeJqvqgH9Q5CA+iKCZ2gyEVpxRU= github.com/go-gl/glfw/v3.3/glfw v0.0.0-20191125211704-12ad95a8df72/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8= github.com/go-gl/glfw/v3.3/glfw v0.0.0-20200222043503-6f7a984d4dc4/go.mod h1:tQ2UAYgL5IevRw8kRxooKSPJfGvJ9fJQFa0TUsXzTg8= +github.com/go-ini/ini v1.67.0 h1:z6ZrTEZqSWOTyH2FlglNbNgARyHG8oLW9gMELqKr06A= +github.com/go-ini/ini v1.67.0/go.mod h1:ByCAeIL28uOIIG0E3PJtZPDL8WnHpFKFOtgjp+3Ies8= github.com/go-jose/go-jose/v4 v4.0.1 h1:QVEPDE3OluqXBQZDcnNvQrInro2h0e4eqNbnZSWqS6U= github.com/go-jose/go-jose/v4 v4.0.1/go.mod h1:WVf9LFMHh/QVrmqrOfqun0C45tMe3RoiKJMPvgWwLfY= github.com/go-logr/logr v1.2.2/go.mod h1:jdQByPbusPIv2/zmleS9BjJVeZ6kBagPoEUsqbVz/1A= @@ -254,8 +256,8 @@ github.com/go-test/deep v1.0.8 h1:TDsG77qcSprGbC6vTN8OuXp5g+J+b5Pcguhf7Zt61VM= github.com/go-test/deep v1.0.8/go.mod h1:5C2ZWiW0ErCdrYzpqxLbTX7MG14M9iiw8DgHncVwcsE= github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850 h1:PSPmmucxGiFBtbQcttHTUc4LQ3P09AW+ldO2qspyKdY= github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850/go.mod h1:aUCEOzzezBEjDBbFBoSiya/gduyIiWYRP6CnSFIV8AM= -github.com/goccy/go-json v0.10.2 h1:CrxCmQqYDkv1z7lO7Wbh2HN93uovUHgrECaO5ZrCXAU= -github.com/goccy/go-json v0.10.2/go.mod h1:6MelG93GURQebXPDq3khkgXZkazVtN9CRI+MGFi0w8I= +github.com/goccy/go-json v0.10.3 h1:KZ5WoDbxAIgm2HNbYckL0se1fHD6rz5j4ywS6ebzDqA= +github.com/goccy/go-json v0.10.3/go.mod h1:oq7eo15ShAhp70Anwd5lgX2pLfOS3QCiwU/PULtXL6M= github.com/godbus/dbus/v5 v5.0.4 h1:9349emZab16e7zQvpmsbtjc18ykshndd8y2PG3sgJbA= github.com/godbus/dbus/v5 v5.0.4/go.mod h1:xhWf0FNVPg57R7Z0UbKHbJfkEywrmjJnf7w5xrFpKfA= github.com/golang-jwt/jwt v3.2.1+incompatible/go.mod h1:8pz2t5EyA70fFQQSrl6XZXzqecmYZeUEB8OUGHkxJ+I= @@ -391,12 +393,12 @@ github.com/k0kubun/colorstring v0.0.0-20150214042306-9440f1994b88/go.mod h1:3w7q github.com/kisielk/gotool v1.0.0/go.mod h1:XhKaO+MFFWcvkIS/tQcRk01m1F5IRFswLeQ+oQHNcck= github.com/klauspost/compress v1.10.4/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs= github.com/klauspost/compress v1.10.10/go.mod h1:aoV0uJVorq1K+umq18yTdKaF57EivdYsUV+/s2qKfXs= -github.com/klauspost/compress v1.17.8 h1:YcnTYrq7MikUT7k0Yb5eceMmALQPYBW/Xltxn0NAMnU= -github.com/klauspost/compress v1.17.8/go.mod h1:Di0epgTjJY877eYKx5yC51cX2A2Vl2ibi7bDH9ttBbw= +github.com/klauspost/compress v1.17.9 h1:6KIumPrER1LHsvBVuDa0r5xaG0Es51mhhB9BQB2qeMA= +github.com/klauspost/compress v1.17.9/go.mod h1:Di0epgTjJY877eYKx5yC51cX2A2Vl2ibi7bDH9ttBbw= github.com/klauspost/cpuid/v2 v2.0.1/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= github.com/klauspost/cpuid/v2 v2.0.9/go.mod h1:FInQzS24/EEf25PyTYn52gqo7WaD8xa0213Md/qVLRg= -github.com/klauspost/cpuid/v2 v2.2.7 h1:ZWSB3igEs+d0qvnxR/ZBzXVmxkgt8DdzP6m9pfuVLDM= -github.com/klauspost/cpuid/v2 v2.2.7/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= +github.com/klauspost/cpuid/v2 v2.2.8 h1:+StwCXwm9PdpiEkPyzBXIy+M9KUb4ODm0Zarf1kS5BM= +github.com/klauspost/cpuid/v2 v2.2.8/go.mod h1:Lcz8mBdAVJIBVzewtcLocK12l3Y+JytZYpaMropDUws= github.com/knz/go-libedit v1.10.1/go.mod h1:MZTVkCWyz0oBc7JOWP3wNAzd002ZbM/5hgShxwh4x8M= github.com/kr/pretty v0.1.0/go.mod h1:dAy3ld7l9f0ibDNOQOHHMYYIIbhfbHSm3C4ZsoJORNo= github.com/kr/pretty v0.3.1 h1:flRD4NNwYAUpkphVc1HcthR4KEIFJ65n8Mw5qdRn3LE= @@ -422,8 +424,8 @@ github.com/miekg/dns v1.1.61 h1:nLxbwF3XxhwVSm8g9Dghm9MHPaUZuqhPiGL+675ZmEs= github.com/miekg/dns v1.1.61/go.mod h1:mnAarhS3nWaW+NVP2wTkYVIZyHNJ098SJZUki3eykwQ= github.com/minio/md5-simd v1.1.2 h1:Gdi1DZK69+ZVMoNHRXJyNcxrMA4dSxoYHZSQbirFg34= github.com/minio/md5-simd v1.1.2/go.mod h1:MzdKDxYpY2BT9XQFocsiZf/NKVtR7nkE4RoEpN+20RM= -github.com/minio/minio-go/v7 v7.0.72 h1:ZSbxs2BfJensLyHdVOgHv+pfmvxYraaUy07ER04dWnA= -github.com/minio/minio-go/v7 v7.0.72/go.mod h1:4yBA8v80xGA30cfM3fz0DKYMXunWl/AV/6tWEs9ryzo= +github.com/minio/minio-go/v7 v7.0.73 h1:qr2vi96Qm7kZ4v7LLebjte+MQh621fFWnv93p12htEo= +github.com/minio/minio-go/v7 v7.0.73/go.mod h1:qydcVzV8Hqtj1VtEocfxbmVFa2siu6HGa+LDEPogjD8= github.com/mitchellh/copystructure v1.0.0/go.mod h1:SNtv71yrdKgLRyLFxmLdkAbkKEFWgYaq1OVrnRcwhnw= github.com/mitchellh/copystructure v1.2.0 h1:vpKXTN4ewci03Vljg/q9QvCGUDttBOGBIa15WveJJGw= github.com/mitchellh/copystructure v1.2.0/go.mod h1:qLl+cE2AmVv+CoeAwDPye/v+N2HKCj9FbZEVFJRxO9s= diff --git a/vendor/github.com/go-ini/ini/.editorconfig b/vendor/github.com/go-ini/ini/.editorconfig new file mode 100644 index 000000000..4a2d9180f --- /dev/null +++ b/vendor/github.com/go-ini/ini/.editorconfig @@ -0,0 +1,12 @@ +# http://editorconfig.org + +root = true + +[*] +charset = utf-8 +end_of_line = lf +insert_final_newline = true +trim_trailing_whitespace = true + +[*_test.go] +trim_trailing_whitespace = false diff --git a/vendor/github.com/go-ini/ini/.gitignore b/vendor/github.com/go-ini/ini/.gitignore new file mode 100644 index 000000000..588388bda --- /dev/null +++ b/vendor/github.com/go-ini/ini/.gitignore @@ -0,0 +1,7 @@ +testdata/conf_out.ini +ini.sublime-project +ini.sublime-workspace +testdata/conf_reflect.ini +.idea +/.vscode +.DS_Store diff --git a/vendor/github.com/go-ini/ini/.golangci.yml b/vendor/github.com/go-ini/ini/.golangci.yml new file mode 100644 index 000000000..631e36925 --- /dev/null +++ b/vendor/github.com/go-ini/ini/.golangci.yml @@ -0,0 +1,27 @@ +linters-settings: + staticcheck: + checks: [ + "all", + "-SA1019" # There are valid use cases of strings.Title + ] + nakedret: + max-func-lines: 0 # Disallow any unnamed return statement + +linters: + enable: + - deadcode + - errcheck + - gosimple + - govet + - ineffassign + - staticcheck + - structcheck + - typecheck + - unused + - varcheck + - nakedret + - gofmt + - rowserrcheck + - unconvert + - goimports + - unparam diff --git a/vendor/github.com/go-ini/ini/LICENSE b/vendor/github.com/go-ini/ini/LICENSE new file mode 100644 index 000000000..d361bbcdf --- /dev/null +++ b/vendor/github.com/go-ini/ini/LICENSE @@ -0,0 +1,191 @@ +Apache License +Version 2.0, January 2004 +http://www.apache.org/licenses/ + +TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION + +1. Definitions. + +"License" shall mean the terms and conditions for use, reproduction, and +distribution as defined by Sections 1 through 9 of this document. + +"Licensor" shall mean the copyright owner or entity authorized by the copyright +owner that is granting the License. + +"Legal Entity" shall mean the union of the acting entity and all other entities +that control, are controlled by, or are under common control with that entity. +For the purposes of this definition, "control" means (i) the power, direct or +indirect, to cause the direction or management of such entity, whether by +contract or otherwise, or (ii) ownership of fifty percent (50%) or more of the +outstanding shares, or (iii) beneficial ownership of such entity. + +"You" (or "Your") shall mean an individual or Legal Entity exercising +permissions granted by this License. + +"Source" form shall mean the preferred form for making modifications, including +but not limited to software source code, documentation source, and configuration +files. + +"Object" form shall mean any form resulting from mechanical transformation or +translation of a Source form, including but not limited to compiled object code, +generated documentation, and conversions to other media types. + +"Work" shall mean the work of authorship, whether in Source or Object form, made +available under the License, as indicated by a copyright notice that is included +in or attached to the work (an example is provided in the Appendix below). + +"Derivative Works" shall mean any work, whether in Source or Object form, that +is based on (or derived from) the Work and for which the editorial revisions, +annotations, elaborations, or other modifications represent, as a whole, an +original work of authorship. For the purposes of this License, Derivative Works +shall not include works that remain separable from, or merely link (or bind by +name) to the interfaces of, the Work and Derivative Works thereof. + +"Contribution" shall mean any work of authorship, including the original version +of the Work and any modifications or additions to that Work or Derivative Works +thereof, that is intentionally submitted to Licensor for inclusion in the Work +by the copyright owner or by an individual or Legal Entity authorized to submit +on behalf of the copyright owner. For the purposes of this definition, +"submitted" means any form of electronic, verbal, or written communication sent +to the Licensor or its representatives, including but not limited to +communication on electronic mailing lists, source code control systems, and +issue tracking systems that are managed by, or on behalf of, the Licensor for +the purpose of discussing and improving the Work, but excluding communication +that is conspicuously marked or otherwise designated in writing by the copyright +owner as "Not a Contribution." + +"Contributor" shall mean Licensor and any individual or Legal Entity on behalf +of whom a Contribution has been received by Licensor and subsequently +incorporated within the Work. + +2. Grant of Copyright License. + +Subject to the terms and conditions of this License, each Contributor hereby +grants to You a perpetual, worldwide, non-exclusive, no-charge, royalty-free, +irrevocable copyright license to reproduce, prepare Derivative Works of, +publicly display, publicly perform, sublicense, and distribute the Work and such +Derivative Works in Source or Object form. + +3. Grant of Patent License. + +Subject to the terms and conditions of this License, each Contributor hereby +grants to You a perpetual, worldwide, non-exclusive, no-charge, royalty-free, +irrevocable (except as stated in this section) patent license to make, have +made, use, offer to sell, sell, import, and otherwise transfer the Work, where +such license applies only to those patent claims licensable by such Contributor +that are necessarily infringed by their Contribution(s) alone or by combination +of their Contribution(s) with the Work to which such Contribution(s) was +submitted. If You institute patent litigation against any entity (including a +cross-claim or counterclaim in a lawsuit) alleging that the Work or a +Contribution incorporated within the Work constitutes direct or contributory +patent infringement, then any patent licenses granted to You under this License +for that Work shall terminate as of the date such litigation is filed. + +4. Redistribution. + +You may reproduce and distribute copies of the Work or Derivative Works thereof +in any medium, with or without modifications, and in Source or Object form, +provided that You meet the following conditions: + +You must give any other recipients of the Work or Derivative Works a copy of +this License; and +You must cause any modified files to carry prominent notices stating that You +changed the files; and +You must retain, in the Source form of any Derivative Works that You distribute, +all copyright, patent, trademark, and attribution notices from the Source form +of the Work, excluding those notices that do not pertain to any part of the +Derivative Works; and +If the Work includes a "NOTICE" text file as part of its distribution, then any +Derivative Works that You distribute must include a readable copy of the +attribution notices contained within such NOTICE file, excluding those notices +that do not pertain to any part of the Derivative Works, in at least one of the +following places: within a NOTICE text file distributed as part of the +Derivative Works; within the Source form or documentation, if provided along +with the Derivative Works; or, within a display generated by the Derivative +Works, if and wherever such third-party notices normally appear. The contents of +the NOTICE file are for informational purposes only and do not modify the +License. You may add Your own attribution notices within Derivative Works that +You distribute, alongside or as an addendum to the NOTICE text from the Work, +provided that such additional attribution notices cannot be construed as +modifying the License. +You may add Your own copyright statement to Your modifications and may provide +additional or different license terms and conditions for use, reproduction, or +distribution of Your modifications, or for any such Derivative Works as a whole, +provided Your use, reproduction, and distribution of the Work otherwise complies +with the conditions stated in this License. + +5. Submission of Contributions. + +Unless You explicitly state otherwise, any Contribution intentionally submitted +for inclusion in the Work by You to the Licensor shall be under the terms and +conditions of this License, without any additional terms or conditions. +Notwithstanding the above, nothing herein shall supersede or modify the terms of +any separate license agreement you may have executed with Licensor regarding +such Contributions. + +6. Trademarks. + +This License does not grant permission to use the trade names, trademarks, +service marks, or product names of the Licensor, except as required for +reasonable and customary use in describing the origin of the Work and +reproducing the content of the NOTICE file. + +7. Disclaimer of Warranty. + +Unless required by applicable law or agreed to in writing, Licensor provides the +Work (and each Contributor provides its Contributions) on an "AS IS" BASIS, +WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied, +including, without limitation, any warranties or conditions of TITLE, +NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A PARTICULAR PURPOSE. You are +solely responsible for determining the appropriateness of using or +redistributing the Work and assume any risks associated with Your exercise of +permissions under this License. + +8. Limitation of Liability. + +In no event and under no legal theory, whether in tort (including negligence), +contract, or otherwise, unless required by applicable law (such as deliberate +and grossly negligent acts) or agreed to in writing, shall any Contributor be +liable to You for damages, including any direct, indirect, special, incidental, +or consequential damages of any character arising as a result of this License or +out of the use or inability to use the Work (including but not limited to +damages for loss of goodwill, work stoppage, computer failure or malfunction, or +any and all other commercial damages or losses), even if such Contributor has +been advised of the possibility of such damages. + +9. Accepting Warranty or Additional Liability. + +While redistributing the Work or Derivative Works thereof, You may choose to +offer, and charge a fee for, acceptance of support, warranty, indemnity, or +other liability obligations and/or rights consistent with this License. However, +in accepting such obligations, You may act only on Your own behalf and on Your +sole responsibility, not on behalf of any other Contributor, and only if You +agree to indemnify, defend, and hold each Contributor harmless for any liability +incurred by, or claims asserted against, such Contributor by reason of your +accepting any such warranty or additional liability. + +END OF TERMS AND CONDITIONS + +APPENDIX: How to apply the Apache License to your work + +To apply the Apache License to your work, attach the following boilerplate +notice, with the fields enclosed by brackets "[]" replaced with your own +identifying information. (Don't include the brackets!) The text should be +enclosed in the appropriate comment syntax for the file format. We also +recommend that a file or class name and description of purpose be included on +the same "printed page" as the copyright notice for easier identification within +third-party archives. + + Copyright 2014 Unknwon + + Licensed under the Apache License, Version 2.0 (the "License"); + you may not use this file except in compliance with the License. + You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + + Unless required by applicable law or agreed to in writing, software + distributed under the License is distributed on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + See the License for the specific language governing permissions and + limitations under the License. diff --git a/vendor/github.com/go-ini/ini/Makefile b/vendor/github.com/go-ini/ini/Makefile new file mode 100644 index 000000000..f3b0dae2d --- /dev/null +++ b/vendor/github.com/go-ini/ini/Makefile @@ -0,0 +1,15 @@ +.PHONY: build test bench vet coverage + +build: vet bench + +test: + go test -v -cover -race + +bench: + go test -v -cover -test.bench=. -test.benchmem + +vet: + go vet + +coverage: + go test -coverprofile=c.out && go tool cover -html=c.out && rm c.out diff --git a/vendor/github.com/go-ini/ini/README.md b/vendor/github.com/go-ini/ini/README.md new file mode 100644 index 000000000..30606d970 --- /dev/null +++ b/vendor/github.com/go-ini/ini/README.md @@ -0,0 +1,43 @@ +# INI + +[![GitHub Workflow Status](https://img.shields.io/github/checks-status/go-ini/ini/main?logo=github&style=for-the-badge)](https://github.com/go-ini/ini/actions?query=branch%3Amain) +[![codecov](https://img.shields.io/codecov/c/github/go-ini/ini/master?logo=codecov&style=for-the-badge)](https://codecov.io/gh/go-ini/ini) +[![GoDoc](https://img.shields.io/badge/GoDoc-Reference-blue?style=for-the-badge&logo=go)](https://pkg.go.dev/github.com/go-ini/ini?tab=doc) +[![Sourcegraph](https://img.shields.io/badge/view%20on-Sourcegraph-brightgreen.svg?style=for-the-badge&logo=sourcegraph)](https://sourcegraph.com/github.com/go-ini/ini) + +![](https://avatars0.githubusercontent.com/u/10216035?v=3&s=200) + +Package ini provides INI file read and write functionality in Go. + +## Features + +- Load from multiple data sources(file, `[]byte`, `io.Reader` and `io.ReadCloser`) with overwrites. +- Read with recursion values. +- Read with parent-child sections. +- Read with auto-increment key names. +- Read with multiple-line values. +- Read with tons of helper methods. +- Read and convert values to Go types. +- Read and **WRITE** comments of sections and keys. +- Manipulate sections, keys and comments with ease. +- Keep sections and keys in order as you parse and save. + +## Installation + +The minimum requirement of Go is **1.13**. + +```sh +$ go get gopkg.in/ini.v1 +``` + +Please add `-u` flag to update in the future. + +## Getting Help + +- [Getting Started](https://ini.unknwon.io/docs/intro/getting_started) +- [API Documentation](https://gowalker.org/gopkg.in/ini.v1) +- 中国大陆镜像：https://ini.unknwon.cn + +## License + +This project is under Apache v2 License. See the [LICENSE](LICENSE) file for the full license text. diff --git a/vendor/github.com/go-ini/ini/codecov.yml b/vendor/github.com/go-ini/ini/codecov.yml new file mode 100644 index 000000000..e02ec84bc --- /dev/null +++ b/vendor/github.com/go-ini/ini/codecov.yml @@ -0,0 +1,16 @@ +coverage: + range: "60...95" + status: + project: + default: + threshold: 1% + informational: true + patch: + defualt: + only_pulls: true + informational: true + +comment: + layout: 'diff' + +github_checks: false diff --git a/vendor/github.com/go-ini/ini/data_source.go b/vendor/github.com/go-ini/ini/data_source.go new file mode 100644 index 000000000..c3a541f1d --- /dev/null +++ b/vendor/github.com/go-ini/ini/data_source.go @@ -0,0 +1,76 @@ +// Copyright 2019 Unknwon +// +// Licensed under the Apache License, Version 2.0 (the "License"): you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT +// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the +// License for the specific language governing permissions and limitations +// under the License. + +package ini + +import ( + "bytes" + "fmt" + "io" + "io/ioutil" + "os" +) + +var ( + _ dataSource = (*sourceFile)(nil) + _ dataSource = (*sourceData)(nil) + _ dataSource = (*sourceReadCloser)(nil) +) + +// dataSource is an interface that returns object which can be read and closed. +type dataSource interface { + ReadCloser() (io.ReadCloser, error) +} + +// sourceFile represents an object that contains content on the local file system. +type sourceFile struct { + name string +} + +func (s sourceFile) ReadCloser() (_ io.ReadCloser, err error) { + return os.Open(s.name) +} + +// sourceData represents an object that contains content in memory. +type sourceData struct { + data []byte +} + +func (s *sourceData) ReadCloser() (io.ReadCloser, error) { + return ioutil.NopCloser(bytes.NewReader(s.data)), nil +} + +// sourceReadCloser represents an input stream with Close method. +type sourceReadCloser struct { + reader io.ReadCloser +} + +func (s *sourceReadCloser) ReadCloser() (io.ReadCloser, error) { + return s.reader, nil +} + +func parseDataSource(source interface{}) (dataSource, error) { + switch s := source.(type) { + case string: + return sourceFile{s}, nil + case []byte: + return &sourceData{s}, nil + case io.ReadCloser: + return &sourceReadCloser{s}, nil + case io.Reader: + return &sourceReadCloser{ioutil.NopCloser(s)}, nil + default: + return nil, fmt.Errorf("error parsing data source: unknown type %q", s) + } +} diff --git a/vendor/github.com/go-ini/ini/deprecated.go b/vendor/github.com/go-ini/ini/deprecated.go new file mode 100644 index 000000000..48b8e66d6 --- /dev/null +++ b/vendor/github.com/go-ini/ini/deprecated.go @@ -0,0 +1,22 @@ +// Copyright 2019 Unknwon +// +// Licensed under the Apache License, Version 2.0 (the "License"): you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT +// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the +// License for the specific language governing permissions and limitations +// under the License. + +package ini + +var ( + // Deprecated: Use "DefaultSection" instead. + DEFAULT_SECTION = DefaultSection + // Deprecated: AllCapsUnderscore converts to format ALL_CAPS_UNDERSCORE. + AllCapsUnderscore = SnackCase +) diff --git a/vendor/github.com/go-ini/ini/error.go b/vendor/github.com/go-ini/ini/error.go new file mode 100644 index 000000000..f66bc94b8 --- /dev/null +++ b/vendor/github.com/go-ini/ini/error.go @@ -0,0 +1,49 @@ +// Copyright 2016 Unknwon +// +// Licensed under the Apache License, Version 2.0 (the "License"): you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT +// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the +// License for the specific language governing permissions and limitations +// under the License. + +package ini + +import ( + "fmt" +) + +// ErrDelimiterNotFound indicates the error type of no delimiter is found which there should be one. +type ErrDelimiterNotFound struct { + Line string +} + +// IsErrDelimiterNotFound returns true if the given error is an instance of ErrDelimiterNotFound. +func IsErrDelimiterNotFound(err error) bool { + _, ok := err.(ErrDelimiterNotFound) + return ok +} + +func (err ErrDelimiterNotFound) Error() string { + return fmt.Sprintf("key-value delimiter not found: %s", err.Line) +} + +// ErrEmptyKeyName indicates the error type of no key name is found which there should be one. +type ErrEmptyKeyName struct { + Line string +} + +// IsErrEmptyKeyName returns true if the given error is an instance of ErrEmptyKeyName. +func IsErrEmptyKeyName(err error) bool { + _, ok := err.(ErrEmptyKeyName) + return ok +} + +func (err ErrEmptyKeyName) Error() string { + return fmt.Sprintf("empty key name: %s", err.Line) +} diff --git a/vendor/github.com/go-ini/ini/file.go b/vendor/github.com/go-ini/ini/file.go new file mode 100644 index 000000000..f8b22408b --- /dev/null +++ b/vendor/github.com/go-ini/ini/file.go @@ -0,0 +1,541 @@ +// Copyright 2017 Unknwon +// +// Licensed under the Apache License, Version 2.0 (the "License"): you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT +// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the +// License for the specific language governing permissions and limitations +// under the License. + +package ini + +import ( + "bytes" + "errors" + "fmt" + "io" + "io/ioutil" + "os" + "strings" + "sync" +) + +// File represents a combination of one or more INI files in memory. +type File struct { + options LoadOptions + dataSources []dataSource + + // Should make things safe, but sometimes doesn't matter. + BlockMode bool + lock sync.RWMutex + + // To keep data in order. + sectionList []string + // To keep track of the index of a section with same name. + // This meta list is only used with non-unique section names are allowed. + sectionIndexes []int + + // Actual data is stored here. + sections map[string][]*Section + + NameMapper + ValueMapper +} + +// newFile initializes File object with given data sources. +func newFile(dataSources []dataSource, opts LoadOptions) *File { + if len(opts.KeyValueDelimiters) == 0 { + opts.KeyValueDelimiters = "=:" + } + if len(opts.KeyValueDelimiterOnWrite) == 0 { + opts.KeyValueDelimiterOnWrite = "=" + } + if len(opts.ChildSectionDelimiter) == 0 { + opts.ChildSectionDelimiter = "." + } + + return &File{ + BlockMode: true, + dataSources: dataSources, + sections: make(map[string][]*Section), + options: opts, + } +} + +// Empty returns an empty file object. +func Empty(opts ...LoadOptions) *File { + var opt LoadOptions + if len(opts) > 0 { + opt = opts[0] + } + + // Ignore error here, we are sure our data is good. + f, _ := LoadSources(opt, []byte("")) + return f +} + +// NewSection creates a new section. +func (f *File) NewSection(name string) (*Section, error) { + if len(name) == 0 { + return nil, errors.New("empty section name") + } + + if (f.options.Insensitive || f.options.InsensitiveSections) && name != DefaultSection { + name = strings.ToLower(name) + } + + if f.BlockMode { + f.lock.Lock() + defer f.lock.Unlock() + } + + if !f.options.AllowNonUniqueSections && inSlice(name, f.sectionList) { + return f.sections[name][0], nil + } + + f.sectionList = append(f.sectionList, name) + + // NOTE: Append to indexes must happen before appending to sections, + // otherwise index will have off-by-one problem. + f.sectionIndexes = append(f.sectionIndexes, len(f.sections[name])) + + sec := newSection(f, name) + f.sections[name] = append(f.sections[name], sec) + + return sec, nil +} + +// NewRawSection creates a new section with an unparseable body. +func (f *File) NewRawSection(name, body string) (*Section, error) { + section, err := f.NewSection(name) + if err != nil { + return nil, err + } + + section.isRawSection = true + section.rawBody = body + return section, nil +} + +// NewSections creates a list of sections. +func (f *File) NewSections(names ...string) (err error) { + for _, name := range names { + if _, err = f.NewSection(name); err != nil { + return err + } + } + return nil +} + +// GetSection returns section by given name. +func (f *File) GetSection(name string) (*Section, error) { + secs, err := f.SectionsByName(name) + if err != nil { + return nil, err + } + + return secs[0], err +} + +// HasSection returns true if the file contains a section with given name. +func (f *File) HasSection(name string) bool { + section, _ := f.GetSection(name) + return section != nil +} + +// SectionsByName returns all sections with given name. +func (f *File) SectionsByName(name string) ([]*Section, error) { + if len(name) == 0 { + name = DefaultSection + } + if f.options.Insensitive || f.options.InsensitiveSections { + name = strings.ToLower(name) + } + + if f.BlockMode { + f.lock.RLock() + defer f.lock.RUnlock() + } + + secs := f.sections[name] + if len(secs) == 0 { + return nil, fmt.Errorf("section %q does not exist", name) + } + + return secs, nil +} + +// Section assumes named section exists and returns a zero-value when not. +func (f *File) Section(name string) *Section { + sec, err := f.GetSection(name) + if err != nil { + if name == "" { + name = DefaultSection + } + sec, _ = f.NewSection(name) + return sec + } + return sec +} + +// SectionWithIndex assumes named section exists and returns a new section when not. +func (f *File) SectionWithIndex(name string, index int) *Section { + secs, err := f.SectionsByName(name) + if err != nil || len(secs) <= index { + // NOTE: It's OK here because the only possible error is empty section name, + // but if it's empty, this piece of code won't be executed. + newSec, _ := f.NewSection(name) + return newSec + } + + return secs[index] +} + +// Sections returns a list of Section stored in the current instance. +func (f *File) Sections() []*Section { + if f.BlockMode { + f.lock.RLock() + defer f.lock.RUnlock() + } + + sections := make([]*Section, len(f.sectionList)) + for i, name := range f.sectionList { + sections[i] = f.sections[name][f.sectionIndexes[i]] + } + return sections +} + +// ChildSections returns a list of child sections of given section name. +func (f *File) ChildSections(name string) []*Section { + return f.Section(name).ChildSections() +} + +// SectionStrings returns list of section names. +func (f *File) SectionStrings() []string { + list := make([]string, len(f.sectionList)) + copy(list, f.sectionList) + return list +} + +// DeleteSection deletes a section or all sections with given name. +func (f *File) DeleteSection(name string) { + secs, err := f.SectionsByName(name) + if err != nil { + return + } + + for i := 0; i < len(secs); i++ { + // For non-unique sections, it is always needed to remove the first one so + // in the next iteration, the subsequent section continue having index 0. + // Ignoring the error as index 0 never returns an error. + _ = f.DeleteSectionWithIndex(name, 0) + } +} + +// DeleteSectionWithIndex deletes a section with given name and index. +func (f *File) DeleteSectionWithIndex(name string, index int) error { + if !f.options.AllowNonUniqueSections && index != 0 { + return fmt.Errorf("delete section with non-zero index is only allowed when non-unique sections is enabled") + } + + if len(name) == 0 { + name = DefaultSection + } + if f.options.Insensitive || f.options.InsensitiveSections { + name = strings.ToLower(name) + } + + if f.BlockMode { + f.lock.Lock() + defer f.lock.Unlock() + } + + // Count occurrences of the sections + occurrences := 0 + + sectionListCopy := make([]string, len(f.sectionList)) + copy(sectionListCopy, f.sectionList) + + for i, s := range sectionListCopy { + if s != name { + continue + } + + if occurrences == index { + if len(f.sections[name]) <= 1 { + delete(f.sections, name) // The last one in the map + } else { + f.sections[name] = append(f.sections[name][:index], f.sections[name][index+1:]...) + } + + // Fix section lists + f.sectionList = append(f.sectionList[:i], f.sectionList[i+1:]...) + f.sectionIndexes = append(f.sectionIndexes[:i], f.sectionIndexes[i+1:]...) + + } else if occurrences > index { + // Fix the indices of all following sections with this name. + f.sectionIndexes[i-1]-- + } + + occurrences++ + } + + return nil +} + +func (f *File) reload(s dataSource) error { + r, err := s.ReadCloser() + if err != nil { + return err + } + defer r.Close() + + return f.parse(r) +} + +// Reload reloads and parses all data sources. +func (f *File) Reload() (err error) { + for _, s := range f.dataSources { + if err = f.reload(s); err != nil { + // In loose mode, we create an empty default section for nonexistent files. + if os.IsNotExist(err) && f.options.Loose { + _ = f.parse(bytes.NewBuffer(nil)) + continue + } + return err + } + if f.options.ShortCircuit { + return nil + } + } + return nil +} + +// Append appends one or more data sources and reloads automatically. +func (f *File) Append(source interface{}, others ...interface{}) error { + ds, err := parseDataSource(source) + if err != nil { + return err + } + f.dataSources = append(f.dataSources, ds) + for _, s := range others { + ds, err = parseDataSource(s) + if err != nil { + return err + } + f.dataSources = append(f.dataSources, ds) + } + return f.Reload() +} + +func (f *File) writeToBuffer(indent string) (*bytes.Buffer, error) { + equalSign := DefaultFormatLeft + f.options.KeyValueDelimiterOnWrite + DefaultFormatRight + + if PrettyFormat || PrettyEqual { + equalSign = fmt.Sprintf(" %s ", f.options.KeyValueDelimiterOnWrite) + } + + // Use buffer to make sure target is safe until finish encoding. + buf := bytes.NewBuffer(nil) + lastSectionIdx := len(f.sectionList) - 1 + for i, sname := range f.sectionList { + sec := f.SectionWithIndex(sname, f.sectionIndexes[i]) + if len(sec.Comment) > 0 { + // Support multiline comments + lines := strings.Split(sec.Comment, LineBreak) + for i := range lines { + if lines[i][0] != '#' && lines[i][0] != ';' { + lines[i] = "; " + lines[i] + } else { + lines[i] = lines[i][:1] + " " + strings.TrimSpace(lines[i][1:]) + } + + if _, err := buf.WriteString(lines[i] + LineBreak); err != nil { + return nil, err + } + } + } + + if i > 0 || DefaultHeader || (i == 0 && strings.ToUpper(sec.name) != DefaultSection) { + if _, err := buf.WriteString("[" + sname + "]" + LineBreak); err != nil { + return nil, err + } + } else { + // Write nothing if default section is empty + if len(sec.keyList) == 0 { + continue + } + } + + isLastSection := i == lastSectionIdx + if sec.isRawSection { + if _, err := buf.WriteString(sec.rawBody); err != nil { + return nil, err + } + + if PrettySection && !isLastSection { + // Put a line between sections + if _, err := buf.WriteString(LineBreak); err != nil { + return nil, err + } + } + continue + } + + // Count and generate alignment length and buffer spaces using the + // longest key. Keys may be modified if they contain certain characters so + // we need to take that into account in our calculation. + alignLength := 0 + if PrettyFormat { + for _, kname := range sec.keyList { + keyLength := len(kname) + // First case will surround key by ` and second by """ + if strings.Contains(kname, "\"") || strings.ContainsAny(kname, f.options.KeyValueDelimiters) { + keyLength += 2 + } else if strings.Contains(kname, "`") { + keyLength += 6 + } + + if keyLength > alignLength { + alignLength = keyLength + } + } + } + alignSpaces := bytes.Repeat([]byte(" "), alignLength) + + KeyList: + for _, kname := range sec.keyList { + key := sec.Key(kname) + if len(key.Comment) > 0 { + if len(indent) > 0 && sname != DefaultSection { + buf.WriteString(indent) + } + + // Support multiline comments + lines := strings.Split(key.Comment, LineBreak) + for i := range lines { + if lines[i][0] != '#' && lines[i][0] != ';' { + lines[i] = "; " + strings.TrimSpace(lines[i]) + } else { + lines[i] = lines[i][:1] + " " + strings.TrimSpace(lines[i][1:]) + } + + if _, err := buf.WriteString(lines[i] + LineBreak); err != nil { + return nil, err + } + } + } + + if len(indent) > 0 && sname != DefaultSection { + buf.WriteString(indent) + } + + switch { + case key.isAutoIncrement: + kname = "-" + case strings.Contains(kname, "\"") || strings.ContainsAny(kname, f.options.KeyValueDelimiters): + kname = "`" + kname + "`" + case strings.Contains(kname, "`"): + kname = `"""` + kname + `"""` + } + + writeKeyValue := func(val string) (bool, error) { + if _, err := buf.WriteString(kname); err != nil { + return false, err + } + + if key.isBooleanType { + buf.WriteString(LineBreak) + return true, nil + } + + // Write out alignment spaces before "=" sign + if PrettyFormat { + buf.Write(alignSpaces[:alignLength-len(kname)]) + } + + // In case key value contains "\n", "`", "\"", "#" or ";" + if strings.ContainsAny(val, "\n`") { + val = `"""` + val + `"""` + } else if !f.options.IgnoreInlineComment && strings.ContainsAny(val, "#;") { + val = "`" + val + "`" + } else if len(strings.TrimSpace(val)) != len(val) { + val = `"` + val + `"` + } + if _, err := buf.WriteString(equalSign + val + LineBreak); err != nil { + return false, err + } + return false, nil + } + + shadows := key.ValueWithShadows() + if len(shadows) == 0 { + if _, err := writeKeyValue(""); err != nil { + return nil, err + } + } + + for _, val := range shadows { + exitLoop, err := writeKeyValue(val) + if err != nil { + return nil, err + } else if exitLoop { + continue KeyList + } + } + + for _, val := range key.nestedValues { + if _, err := buf.WriteString(indent + " " + val + LineBreak); err != nil { + return nil, err + } + } + } + + if PrettySection && !isLastSection { + // Put a line between sections + if _, err := buf.WriteString(LineBreak); err != nil { + return nil, err + } + } + } + + return buf, nil +} + +// WriteToIndent writes content into io.Writer with given indention. +// If PrettyFormat has been set to be true, +// it will align "=" sign with spaces under each section. +func (f *File) WriteToIndent(w io.Writer, indent string) (int64, error) { + buf, err := f.writeToBuffer(indent) + if err != nil { + return 0, err + } + return buf.WriteTo(w) +} + +// WriteTo writes file content into io.Writer. +func (f *File) WriteTo(w io.Writer) (int64, error) { + return f.WriteToIndent(w, "") +} + +// SaveToIndent writes content to file system with given value indention. +func (f *File) SaveToIndent(filename, indent string) error { + // Note: Because we are truncating with os.Create, + // so it's safer to save to a temporary file location and rename after done. + buf, err := f.writeToBuffer(indent) + if err != nil { + return err + } + + return ioutil.WriteFile(filename, buf.Bytes(), 0666) +} + +// SaveTo writes content to file system. +func (f *File) SaveTo(filename string) error { + return f.SaveToIndent(filename, "") +} diff --git a/vendor/github.com/go-ini/ini/helper.go b/vendor/github.com/go-ini/ini/helper.go new file mode 100644 index 000000000..f9d80a682 --- /dev/null +++ b/vendor/github.com/go-ini/ini/helper.go @@ -0,0 +1,24 @@ +// Copyright 2019 Unknwon +// +// Licensed under the Apache License, Version 2.0 (the "License"): you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT +// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the +// License for the specific language governing permissions and limitations +// under the License. + +package ini + +func inSlice(str string, s []string) bool { + for _, v := range s { + if str == v { + return true + } + } + return false +} diff --git a/vendor/github.com/go-ini/ini/ini.go b/vendor/github.com/go-ini/ini/ini.go new file mode 100644 index 000000000..99e7f8651 --- /dev/null +++ b/vendor/github.com/go-ini/ini/ini.go @@ -0,0 +1,176 @@ +// Copyright 2014 Unknwon +// +// Licensed under the Apache License, Version 2.0 (the "License"): you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT +// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the +// License for the specific language governing permissions and limitations +// under the License. + +// Package ini provides INI file read and write functionality in Go. +package ini + +import ( + "os" + "regexp" + "runtime" + "strings" +) + +const ( + // Maximum allowed depth when recursively substituing variable names. + depthValues = 99 +) + +var ( + // DefaultSection is the name of default section. You can use this var or the string literal. + // In most of cases, an empty string is all you need to access the section. + DefaultSection = "DEFAULT" + + // LineBreak is the delimiter to determine or compose a new line. + // This variable will be changed to "\r\n" automatically on Windows at package init time. + LineBreak = "\n" + + // Variable regexp pattern: %(variable)s + varPattern = regexp.MustCompile(`%\(([^)]+)\)s`) + + // DefaultHeader explicitly writes default section header. + DefaultHeader = false + + // PrettySection indicates whether to put a line between sections. + PrettySection = true + // PrettyFormat indicates whether to align "=" sign with spaces to produce pretty output + // or reduce all possible spaces for compact format. + PrettyFormat = true + // PrettyEqual places spaces around "=" sign even when PrettyFormat is false. + PrettyEqual = false + // DefaultFormatLeft places custom spaces on the left when PrettyFormat and PrettyEqual are both disabled. + DefaultFormatLeft = "" + // DefaultFormatRight places custom spaces on the right when PrettyFormat and PrettyEqual are both disabled. + DefaultFormatRight = "" +) + +var inTest = len(os.Args) > 0 && strings.HasSuffix(strings.TrimSuffix(os.Args[0], ".exe"), ".test") + +func init() { + if runtime.GOOS == "windows" && !inTest { + LineBreak = "\r\n" + } +} + +// LoadOptions contains all customized options used for load data source(s). +type LoadOptions struct { + // Loose indicates whether the parser should ignore nonexistent files or return error. + Loose bool + // Insensitive indicates whether the parser forces all section and key names to lowercase. + Insensitive bool + // InsensitiveSections indicates whether the parser forces all section to lowercase. + InsensitiveSections bool + // InsensitiveKeys indicates whether the parser forces all key names to lowercase. + InsensitiveKeys bool + // IgnoreContinuation indicates whether to ignore continuation lines while parsing. + IgnoreContinuation bool + // IgnoreInlineComment indicates whether to ignore comments at the end of value and treat it as part of value. + IgnoreInlineComment bool + // SkipUnrecognizableLines indicates whether to skip unrecognizable lines that do not conform to key/value pairs. + SkipUnrecognizableLines bool + // ShortCircuit indicates whether to ignore other configuration sources after loaded the first available configuration source. + ShortCircuit bool + // AllowBooleanKeys indicates whether to allow boolean type keys or treat as value is missing. + // This type of keys are mostly used in my.cnf. + AllowBooleanKeys bool + // AllowShadows indicates whether to keep track of keys with same name under same section. + AllowShadows bool + // AllowNestedValues indicates whether to allow AWS-like nested values. + // Docs: http://docs.aws.amazon.com/cli/latest/topic/config-vars.html#nested-values + AllowNestedValues bool + // AllowPythonMultilineValues indicates whether to allow Python-like multi-line values. + // Docs: https://docs.python.org/3/library/configparser.html#supported-ini-file-structure + // Relevant quote: Values can also span multiple lines, as long as they are indented deeper + // than the first line of the value. + AllowPythonMultilineValues bool + // SpaceBeforeInlineComment indicates whether to allow comment symbols (\# and \;) inside value. + // Docs: https://docs.python.org/2/library/configparser.html + // Quote: Comments may appear on their own in an otherwise empty line, or may be entered in lines holding values or section names. + // In the latter case, they need to be preceded by a whitespace character to be recognized as a comment. + SpaceBeforeInlineComment bool + // UnescapeValueDoubleQuotes indicates whether to unescape double quotes inside value to regular format + // when value is surrounded by double quotes, e.g. key="a \"value\"" => key=a "value" + UnescapeValueDoubleQuotes bool + // UnescapeValueCommentSymbols indicates to unescape comment symbols (\# and \;) inside value to regular format + // when value is NOT surrounded by any quotes. + // Note: UNSTABLE, behavior might change to only unescape inside double quotes but may noy necessary at all. + UnescapeValueCommentSymbols bool + // UnparseableSections stores a list of blocks that are allowed with raw content which do not otherwise + // conform to key/value pairs. Specify the names of those blocks here. + UnparseableSections []string + // KeyValueDelimiters is the sequence of delimiters that are used to separate key and value. By default, it is "=:". + KeyValueDelimiters string + // KeyValueDelimiterOnWrite is the delimiter that are used to separate key and value output. By default, it is "=". + KeyValueDelimiterOnWrite string + // ChildSectionDelimiter is the delimiter that is used to separate child sections. By default, it is ".". + ChildSectionDelimiter string + // PreserveSurroundedQuote indicates whether to preserve surrounded quote (single and double quotes). + PreserveSurroundedQuote bool + // DebugFunc is called to collect debug information (currently only useful to debug parsing Python-style multiline values). + DebugFunc DebugFunc + // ReaderBufferSize is the buffer size of the reader in bytes. + ReaderBufferSize int + // AllowNonUniqueSections indicates whether to allow sections with the same name multiple times. + AllowNonUniqueSections bool + // AllowDuplicateShadowValues indicates whether values for shadowed keys should be deduplicated. + AllowDuplicateShadowValues bool +} + +// DebugFunc is the type of function called to log parse events. +type DebugFunc func(message string) + +// LoadSources allows caller to apply customized options for loading from data source(s). +func LoadSources(opts LoadOptions, source interface{}, others ...interface{}) (_ *File, err error) { + sources := make([]dataSource, len(others)+1) + sources[0], err = parseDataSource(source) + if err != nil { + return nil, err + } + for i := range others { + sources[i+1], err = parseDataSource(others[i]) + if err != nil { + return nil, err + } + } + f := newFile(sources, opts) + if err = f.Reload(); err != nil { + return nil, err + } + return f, nil +} + +// Load loads and parses from INI data sources. +// Arguments can be mixed of file name with string type, or raw data in []byte. +// It will return error if list contains nonexistent files. +func Load(source interface{}, others ...interface{}) (*File, error) { + return LoadSources(LoadOptions{}, source, others...) +} + +// LooseLoad has exactly same functionality as Load function +// except it ignores nonexistent files instead of returning error. +func LooseLoad(source interface{}, others ...interface{}) (*File, error) { + return LoadSources(LoadOptions{Loose: true}, source, others...) +} + +// InsensitiveLoad has exactly same functionality as Load function +// except it forces all section and key names to be lowercased. +func InsensitiveLoad(source interface{}, others ...interface{}) (*File, error) { + return LoadSources(LoadOptions{Insensitive: true}, source, others...) +} + +// ShadowLoad has exactly same functionality as Load function +// except it allows have shadow keys. +func ShadowLoad(source interface{}, others ...interface{}) (*File, error) { + return LoadSources(LoadOptions{AllowShadows: true}, source, others...) +} diff --git a/vendor/github.com/go-ini/ini/key.go b/vendor/github.com/go-ini/ini/key.go new file mode 100644 index 000000000..a19d9f38e --- /dev/null +++ b/vendor/github.com/go-ini/ini/key.go @@ -0,0 +1,837 @@ +// Copyright 2014 Unknwon +// +// Licensed under the Apache License, Version 2.0 (the "License"): you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT +// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the +// License for the specific language governing permissions and limitations +// under the License. + +package ini + +import ( + "bytes" + "errors" + "fmt" + "strconv" + "strings" + "time" +) + +// Key represents a key under a section. +type Key struct { + s *Section + Comment string + name string + value string + isAutoIncrement bool + isBooleanType bool + + isShadow bool + shadows []*Key + + nestedValues []string +} + +// newKey simply return a key object with given values. +func newKey(s *Section, name, val string) *Key { + return &Key{ + s: s, + name: name, + value: val, + } +} + +func (k *Key) addShadow(val string) error { + if k.isShadow { + return errors.New("cannot add shadow to another shadow key") + } else if k.isAutoIncrement || k.isBooleanType { + return errors.New("cannot add shadow to auto-increment or boolean key") + } + + if !k.s.f.options.AllowDuplicateShadowValues { + // Deduplicate shadows based on their values. + if k.value == val { + return nil + } + for i := range k.shadows { + if k.shadows[i].value == val { + return nil + } + } + } + + shadow := newKey(k.s, k.name, val) + shadow.isShadow = true + k.shadows = append(k.shadows, shadow) + return nil +} + +// AddShadow adds a new shadow key to itself. +func (k *Key) AddShadow(val string) error { + if !k.s.f.options.AllowShadows { + return errors.New("shadow key is not allowed") + } + return k.addShadow(val) +} + +func (k *Key) addNestedValue(val string) error { + if k.isAutoIncrement || k.isBooleanType { + return errors.New("cannot add nested value to auto-increment or boolean key") + } + + k.nestedValues = append(k.nestedValues, val) + return nil +} + +// AddNestedValue adds a nested value to the key. +func (k *Key) AddNestedValue(val string) error { + if !k.s.f.options.AllowNestedValues { + return errors.New("nested value is not allowed") + } + return k.addNestedValue(val) +} + +// ValueMapper represents a mapping function for values, e.g. os.ExpandEnv +type ValueMapper func(string) string + +// Name returns name of key. +func (k *Key) Name() string { + return k.name +} + +// Value returns raw value of key for performance purpose. +func (k *Key) Value() string { + return k.value +} + +// ValueWithShadows returns raw values of key and its shadows if any. Shadow +// keys with empty values are ignored from the returned list. +func (k *Key) ValueWithShadows() []string { + if len(k.shadows) == 0 { + if k.value == "" { + return []string{} + } + return []string{k.value} + } + + vals := make([]string, 0, len(k.shadows)+1) + if k.value != "" { + vals = append(vals, k.value) + } + for _, s := range k.shadows { + if s.value != "" { + vals = append(vals, s.value) + } + } + return vals +} + +// NestedValues returns nested values stored in the key. +// It is possible returned value is nil if no nested values stored in the key. +func (k *Key) NestedValues() []string { + return k.nestedValues +} + +// transformValue takes a raw value and transforms to its final string. +func (k *Key) transformValue(val string) string { + if k.s.f.ValueMapper != nil { + val = k.s.f.ValueMapper(val) + } + + // Fail-fast if no indicate char found for recursive value + if !strings.Contains(val, "%") { + return val + } + for i := 0; i < depthValues; i++ { + vr := varPattern.FindString(val) + if len(vr) == 0 { + break + } + + // Take off leading '%(' and trailing ')s'. + noption := vr[2 : len(vr)-2] + + // Search in the same section. + // If not found or found the key itself, then search again in default section. + nk, err := k.s.GetKey(noption) + if err != nil || k == nk { + nk, _ = k.s.f.Section("").GetKey(noption) + if nk == nil { + // Stop when no results found in the default section, + // and returns the value as-is. + break + } + } + + // Substitute by new value and take off leading '%(' and trailing ')s'. + val = strings.Replace(val, vr, nk.value, -1) + } + return val +} + +// String returns string representation of value. +func (k *Key) String() string { + return k.transformValue(k.value) +} + +// Validate accepts a validate function which can +// return modifed result as key value. +func (k *Key) Validate(fn func(string) string) string { + return fn(k.String()) +} + +// parseBool returns the boolean value represented by the string. +// +// It accepts 1, t, T, TRUE, true, True, YES, yes, Yes, y, ON, on, On, +// 0, f, F, FALSE, false, False, NO, no, No, n, OFF, off, Off. +// Any other value returns an error. +func parseBool(str string) (value bool, err error) { + switch str { + case "1", "t", "T", "true", "TRUE", "True", "YES", "yes", "Yes", "y", "ON", "on", "On": + return true, nil + case "0", "f", "F", "false", "FALSE", "False", "NO", "no", "No", "n", "OFF", "off", "Off": + return false, nil + } + return false, fmt.Errorf("parsing \"%s\": invalid syntax", str) +} + +// Bool returns bool type value. +func (k *Key) Bool() (bool, error) { + return parseBool(k.String()) +} + +// Float64 returns float64 type value. +func (k *Key) Float64() (float64, error) { + return strconv.ParseFloat(k.String(), 64) +} + +// Int returns int type value. +func (k *Key) Int() (int, error) { + v, err := strconv.ParseInt(k.String(), 0, 64) + return int(v), err +} + +// Int64 returns int64 type value. +func (k *Key) Int64() (int64, error) { + return strconv.ParseInt(k.String(), 0, 64) +} + +// Uint returns uint type valued. +func (k *Key) Uint() (uint, error) { + u, e := strconv.ParseUint(k.String(), 0, 64) + return uint(u), e +} + +// Uint64 returns uint64 type value. +func (k *Key) Uint64() (uint64, error) { + return strconv.ParseUint(k.String(), 0, 64) +} + +// Duration returns time.Duration type value. +func (k *Key) Duration() (time.Duration, error) { + return time.ParseDuration(k.String()) +} + +// TimeFormat parses with given format and returns time.Time type value. +func (k *Key) TimeFormat(format string) (time.Time, error) { + return time.Parse(format, k.String()) +} + +// Time parses with RFC3339 format and returns time.Time type value. +func (k *Key) Time() (time.Time, error) { + return k.TimeFormat(time.RFC3339) +} + +// MustString returns default value if key value is empty. +func (k *Key) MustString(defaultVal string) string { + val := k.String() + if len(val) == 0 { + k.value = defaultVal + return defaultVal + } + return val +} + +// MustBool always returns value without error, +// it returns false if error occurs. +func (k *Key) MustBool(defaultVal ...bool) bool { + val, err := k.Bool() + if len(defaultVal) > 0 && err != nil { + k.value = strconv.FormatBool(defaultVal[0]) + return defaultVal[0] + } + return val +} + +// MustFloat64 always returns value without error, +// it returns 0.0 if error occurs. +func (k *Key) MustFloat64(defaultVal ...float64) float64 { + val, err := k.Float64() + if len(defaultVal) > 0 && err != nil { + k.value = strconv.FormatFloat(defaultVal[0], 'f', -1, 64) + return defaultVal[0] + } + return val +} + +// MustInt always returns value without error, +// it returns 0 if error occurs. +func (k *Key) MustInt(defaultVal ...int) int { + val, err := k.Int() + if len(defaultVal) > 0 && err != nil { + k.value = strconv.FormatInt(int64(defaultVal[0]), 10) + return defaultVal[0] + } + return val +} + +// MustInt64 always returns value without error, +// it returns 0 if error occurs. +func (k *Key) MustInt64(defaultVal ...int64) int64 { + val, err := k.Int64() + if len(defaultVal) > 0 && err != nil { + k.value = strconv.FormatInt(defaultVal[0], 10) + return defaultVal[0] + } + return val +} + +// MustUint always returns value without error, +// it returns 0 if error occurs. +func (k *Key) MustUint(defaultVal ...uint) uint { + val, err := k.Uint() + if len(defaultVal) > 0 && err != nil { + k.value = strconv.FormatUint(uint64(defaultVal[0]), 10) + return defaultVal[0] + } + return val +} + +// MustUint64 always returns value without error, +// it returns 0 if error occurs. +func (k *Key) MustUint64(defaultVal ...uint64) uint64 { + val, err := k.Uint64() + if len(defaultVal) > 0 && err != nil { + k.value = strconv.FormatUint(defaultVal[0], 10) + return defaultVal[0] + } + return val +} + +// MustDuration always returns value without error, +// it returns zero value if error occurs. +func (k *Key) MustDuration(defaultVal ...time.Duration) time.Duration { + val, err := k.Duration() + if len(defaultVal) > 0 && err != nil { + k.value = defaultVal[0].String() + return defaultVal[0] + } + return val +} + +// MustTimeFormat always parses with given format and returns value without error, +// it returns zero value if error occurs. +func (k *Key) MustTimeFormat(format string, defaultVal ...time.Time) time.Time { + val, err := k.TimeFormat(format) + if len(defaultVal) > 0 && err != nil { + k.value = defaultVal[0].Format(format) + return defaultVal[0] + } + return val +} + +// MustTime always parses with RFC3339 format and returns value without error, +// it returns zero value if error occurs. +func (k *Key) MustTime(defaultVal ...time.Time) time.Time { + return k.MustTimeFormat(time.RFC3339, defaultVal...) +} + +// In always returns value without error, +// it returns default value if error occurs or doesn't fit into candidates. +func (k *Key) In(defaultVal string, candidates []string) string { + val := k.String() + for _, cand := range candidates { + if val == cand { + return val + } + } + return defaultVal +} + +// InFloat64 always returns value without error, +// it returns default value if error occurs or doesn't fit into candidates. +func (k *Key) InFloat64(defaultVal float64, candidates []float64) float64 { + val := k.MustFloat64() + for _, cand := range candidates { + if val == cand { + return val + } + } + return defaultVal +} + +// InInt always returns value without error, +// it returns default value if error occurs or doesn't fit into candidates. +func (k *Key) InInt(defaultVal int, candidates []int) int { + val := k.MustInt() + for _, cand := range candidates { + if val == cand { + return val + } + } + return defaultVal +} + +// InInt64 always returns value without error, +// it returns default value if error occurs or doesn't fit into candidates. +func (k *Key) InInt64(defaultVal int64, candidates []int64) int64 { + val := k.MustInt64() + for _, cand := range candidates { + if val == cand { + return val + } + } + return defaultVal +} + +// InUint always returns value without error, +// it returns default value if error occurs or doesn't fit into candidates. +func (k *Key) InUint(defaultVal uint, candidates []uint) uint { + val := k.MustUint() + for _, cand := range candidates { + if val == cand { + return val + } + } + return defaultVal +} + +// InUint64 always returns value without error, +// it returns default value if error occurs or doesn't fit into candidates. +func (k *Key) InUint64(defaultVal uint64, candidates []uint64) uint64 { + val := k.MustUint64() + for _, cand := range candidates { + if val == cand { + return val + } + } + return defaultVal +} + +// InTimeFormat always parses with given format and returns value without error, +// it returns default value if error occurs or doesn't fit into candidates. +func (k *Key) InTimeFormat(format string, defaultVal time.Time, candidates []time.Time) time.Time { + val := k.MustTimeFormat(format) + for _, cand := range candidates { + if val == cand { + return val + } + } + return defaultVal +} + +// InTime always parses with RFC3339 format and returns value without error, +// it returns default value if error occurs or doesn't fit into candidates. +func (k *Key) InTime(defaultVal time.Time, candidates []time.Time) time.Time { + return k.InTimeFormat(time.RFC3339, defaultVal, candidates) +} + +// RangeFloat64 checks if value is in given range inclusively, +// and returns default value if it's not. +func (k *Key) RangeFloat64(defaultVal, min, max float64) float64 { + val := k.MustFloat64() + if val < min || val > max { + return defaultVal + } + return val +} + +// RangeInt checks if value is in given range inclusively, +// and returns default value if it's not. +func (k *Key) RangeInt(defaultVal, min, max int) int { + val := k.MustInt() + if val < min || val > max { + return defaultVal + } + return val +} + +// RangeInt64 checks if value is in given range inclusively, +// and returns default value if it's not. +func (k *Key) RangeInt64(defaultVal, min, max int64) int64 { + val := k.MustInt64() + if val < min || val > max { + return defaultVal + } + return val +} + +// RangeTimeFormat checks if value with given format is in given range inclusively, +// and returns default value if it's not. +func (k *Key) RangeTimeFormat(format string, defaultVal, min, max time.Time) time.Time { + val := k.MustTimeFormat(format) + if val.Unix() < min.Unix() || val.Unix() > max.Unix() { + return defaultVal + } + return val +} + +// RangeTime checks if value with RFC3339 format is in given range inclusively, +// and returns default value if it's not. +func (k *Key) RangeTime(defaultVal, min, max time.Time) time.Time { + return k.RangeTimeFormat(time.RFC3339, defaultVal, min, max) +} + +// Strings returns list of string divided by given delimiter. +func (k *Key) Strings(delim string) []string { + str := k.String() + if len(str) == 0 { + return []string{} + } + + runes := []rune(str) + vals := make([]string, 0, 2) + var buf bytes.Buffer + escape := false + idx := 0 + for { + if escape { + escape = false + if runes[idx] != '\\' && !strings.HasPrefix(string(runes[idx:]), delim) { + buf.WriteRune('\\') + } + buf.WriteRune(runes[idx]) + } else { + if runes[idx] == '\\' { + escape = true + } else if strings.HasPrefix(string(runes[idx:]), delim) { + idx += len(delim) - 1 + vals = append(vals, strings.TrimSpace(buf.String())) + buf.Reset() + } else { + buf.WriteRune(runes[idx]) + } + } + idx++ + if idx == len(runes) { + break + } + } + + if buf.Len() > 0 { + vals = append(vals, strings.TrimSpace(buf.String())) + } + + return vals +} + +// StringsWithShadows returns list of string divided by given delimiter. +// Shadows will also be appended if any. +func (k *Key) StringsWithShadows(delim string) []string { + vals := k.ValueWithShadows() + results := make([]string, 0, len(vals)*2) + for i := range vals { + if len(vals) == 0 { + continue + } + + results = append(results, strings.Split(vals[i], delim)...) + } + + for i := range results { + results[i] = k.transformValue(strings.TrimSpace(results[i])) + } + return results +} + +// Float64s returns list of float64 divided by given delimiter. Any invalid input will be treated as zero value. +func (k *Key) Float64s(delim string) []float64 { + vals, _ := k.parseFloat64s(k.Strings(delim), true, false) + return vals +} + +// Ints returns list of int divided by given delimiter. Any invalid input will be treated as zero value. +func (k *Key) Ints(delim string) []int { + vals, _ := k.parseInts(k.Strings(delim), true, false) + return vals +} + +// Int64s returns list of int64 divided by given delimiter. Any invalid input will be treated as zero value. +func (k *Key) Int64s(delim string) []int64 { + vals, _ := k.parseInt64s(k.Strings(delim), true, false) + return vals +} + +// Uints returns list of uint divided by given delimiter. Any invalid input will be treated as zero value. +func (k *Key) Uints(delim string) []uint { + vals, _ := k.parseUints(k.Strings(delim), true, false) + return vals +} + +// Uint64s returns list of uint64 divided by given delimiter. Any invalid input will be treated as zero value. +func (k *Key) Uint64s(delim string) []uint64 { + vals, _ := k.parseUint64s(k.Strings(delim), true, false) + return vals +} + +// Bools returns list of bool divided by given delimiter. Any invalid input will be treated as zero value. +func (k *Key) Bools(delim string) []bool { + vals, _ := k.parseBools(k.Strings(delim), true, false) + return vals +} + +// TimesFormat parses with given format and returns list of time.Time divided by given delimiter. +// Any invalid input will be treated as zero value (0001-01-01 00:00:00 +0000 UTC). +func (k *Key) TimesFormat(format, delim string) []time.Time { + vals, _ := k.parseTimesFormat(format, k.Strings(delim), true, false) + return vals +} + +// Times parses with RFC3339 format and returns list of time.Time divided by given delimiter. +// Any invalid input will be treated as zero value (0001-01-01 00:00:00 +0000 UTC). +func (k *Key) Times(delim string) []time.Time { + return k.TimesFormat(time.RFC3339, delim) +} + +// ValidFloat64s returns list of float64 divided by given delimiter. If some value is not float, then +// it will not be included to result list. +func (k *Key) ValidFloat64s(delim string) []float64 { + vals, _ := k.parseFloat64s(k.Strings(delim), false, false) + return vals +} + +// ValidInts returns list of int divided by given delimiter. If some value is not integer, then it will +// not be included to result list. +func (k *Key) ValidInts(delim string) []int { + vals, _ := k.parseInts(k.Strings(delim), false, false) + return vals +} + +// ValidInt64s returns list of int64 divided by given delimiter. If some value is not 64-bit integer, +// then it will not be included to result list. +func (k *Key) ValidInt64s(delim string) []int64 { + vals, _ := k.parseInt64s(k.Strings(delim), false, false) + return vals +} + +// ValidUints returns list of uint divided by given delimiter. If some value is not unsigned integer, +// then it will not be included to result list. +func (k *Key) ValidUints(delim string) []uint { + vals, _ := k.parseUints(k.Strings(delim), false, false) + return vals +} + +// ValidUint64s returns list of uint64 divided by given delimiter. If some value is not 64-bit unsigned +// integer, then it will not be included to result list. +func (k *Key) ValidUint64s(delim string) []uint64 { + vals, _ := k.parseUint64s(k.Strings(delim), false, false) + return vals +} + +// ValidBools returns list of bool divided by given delimiter. If some value is not 64-bit unsigned +// integer, then it will not be included to result list. +func (k *Key) ValidBools(delim string) []bool { + vals, _ := k.parseBools(k.Strings(delim), false, false) + return vals +} + +// ValidTimesFormat parses with given format and returns list of time.Time divided by given delimiter. +func (k *Key) ValidTimesFormat(format, delim string) []time.Time { + vals, _ := k.parseTimesFormat(format, k.Strings(delim), false, false) + return vals +} + +// ValidTimes parses with RFC3339 format and returns list of time.Time divided by given delimiter. +func (k *Key) ValidTimes(delim string) []time.Time { + return k.ValidTimesFormat(time.RFC3339, delim) +} + +// StrictFloat64s returns list of float64 divided by given delimiter or error on first invalid input. +func (k *Key) StrictFloat64s(delim string) ([]float64, error) { + return k.parseFloat64s(k.Strings(delim), false, true) +} + +// StrictInts returns list of int divided by given delimiter or error on first invalid input. +func (k *Key) StrictInts(delim string) ([]int, error) { + return k.parseInts(k.Strings(delim), false, true) +} + +// StrictInt64s returns list of int64 divided by given delimiter or error on first invalid input. +func (k *Key) StrictInt64s(delim string) ([]int64, error) { + return k.parseInt64s(k.Strings(delim), false, true) +} + +// StrictUints returns list of uint divided by given delimiter or error on first invalid input. +func (k *Key) StrictUints(delim string) ([]uint, error) { + return k.parseUints(k.Strings(delim), false, true) +} + +// StrictUint64s returns list of uint64 divided by given delimiter or error on first invalid input. +func (k *Key) StrictUint64s(delim string) ([]uint64, error) { + return k.parseUint64s(k.Strings(delim), false, true) +} + +// StrictBools returns list of bool divided by given delimiter or error on first invalid input. +func (k *Key) StrictBools(delim string) ([]bool, error) { + return k.parseBools(k.Strings(delim), false, true) +} + +// StrictTimesFormat parses with given format and returns list of time.Time divided by given delimiter +// or error on first invalid input. +func (k *Key) StrictTimesFormat(format, delim string) ([]time.Time, error) { + return k.parseTimesFormat(format, k.Strings(delim), false, true) +} + +// StrictTimes parses with RFC3339 format and returns list of time.Time divided by given delimiter +// or error on first invalid input. +func (k *Key) StrictTimes(delim string) ([]time.Time, error) { + return k.StrictTimesFormat(time.RFC3339, delim) +} + +// parseBools transforms strings to bools. +func (k *Key) parseBools(strs []string, addInvalid, returnOnInvalid bool) ([]bool, error) { + vals := make([]bool, 0, len(strs)) + parser := func(str string) (interface{}, error) { + val, err := parseBool(str) + return val, err + } + rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser) + if err == nil { + for _, val := range rawVals { + vals = append(vals, val.(bool)) + } + } + return vals, err +} + +// parseFloat64s transforms strings to float64s. +func (k *Key) parseFloat64s(strs []string, addInvalid, returnOnInvalid bool) ([]float64, error) { + vals := make([]float64, 0, len(strs)) + parser := func(str string) (interface{}, error) { + val, err := strconv.ParseFloat(str, 64) + return val, err + } + rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser) + if err == nil { + for _, val := range rawVals { + vals = append(vals, val.(float64)) + } + } + return vals, err +} + +// parseInts transforms strings to ints. +func (k *Key) parseInts(strs []string, addInvalid, returnOnInvalid bool) ([]int, error) { + vals := make([]int, 0, len(strs)) + parser := func(str string) (interface{}, error) { + val, err := strconv.ParseInt(str, 0, 64) + return val, err + } + rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser) + if err == nil { + for _, val := range rawVals { + vals = append(vals, int(val.(int64))) + } + } + return vals, err +} + +// parseInt64s transforms strings to int64s. +func (k *Key) parseInt64s(strs []string, addInvalid, returnOnInvalid bool) ([]int64, error) { + vals := make([]int64, 0, len(strs)) + parser := func(str string) (interface{}, error) { + val, err := strconv.ParseInt(str, 0, 64) + return val, err + } + + rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser) + if err == nil { + for _, val := range rawVals { + vals = append(vals, val.(int64)) + } + } + return vals, err +} + +// parseUints transforms strings to uints. +func (k *Key) parseUints(strs []string, addInvalid, returnOnInvalid bool) ([]uint, error) { + vals := make([]uint, 0, len(strs)) + parser := func(str string) (interface{}, error) { + val, err := strconv.ParseUint(str, 0, 64) + return val, err + } + + rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser) + if err == nil { + for _, val := range rawVals { + vals = append(vals, uint(val.(uint64))) + } + } + return vals, err +} + +// parseUint64s transforms strings to uint64s. +func (k *Key) parseUint64s(strs []string, addInvalid, returnOnInvalid bool) ([]uint64, error) { + vals := make([]uint64, 0, len(strs)) + parser := func(str string) (interface{}, error) { + val, err := strconv.ParseUint(str, 0, 64) + return val, err + } + rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser) + if err == nil { + for _, val := range rawVals { + vals = append(vals, val.(uint64)) + } + } + return vals, err +} + +type Parser func(str string) (interface{}, error) + +// parseTimesFormat transforms strings to times in given format. +func (k *Key) parseTimesFormat(format string, strs []string, addInvalid, returnOnInvalid bool) ([]time.Time, error) { + vals := make([]time.Time, 0, len(strs)) + parser := func(str string) (interface{}, error) { + val, err := time.Parse(format, str) + return val, err + } + rawVals, err := k.doParse(strs, addInvalid, returnOnInvalid, parser) + if err == nil { + for _, val := range rawVals { + vals = append(vals, val.(time.Time)) + } + } + return vals, err +} + +// doParse transforms strings to different types +func (k *Key) doParse(strs []string, addInvalid, returnOnInvalid bool, parser Parser) ([]interface{}, error) { + vals := make([]interface{}, 0, len(strs)) + for _, str := range strs { + val, err := parser(str) + if err != nil && returnOnInvalid { + return nil, err + } + if err == nil || addInvalid { + vals = append(vals, val) + } + } + return vals, nil +} + +// SetValue changes key value. +func (k *Key) SetValue(v string) { + if k.s.f.BlockMode { + k.s.f.lock.Lock() + defer k.s.f.lock.Unlock() + } + + k.value = v + k.s.keysHash[k.name] = v +} diff --git a/vendor/github.com/go-ini/ini/parser.go b/vendor/github.com/go-ini/ini/parser.go new file mode 100644 index 000000000..44fc526c2 --- /dev/null +++ b/vendor/github.com/go-ini/ini/parser.go @@ -0,0 +1,520 @@ +// Copyright 2015 Unknwon +// +// Licensed under the Apache License, Version 2.0 (the "License"): you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT +// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the +// License for the specific language governing permissions and limitations +// under the License. + +package ini + +import ( + "bufio" + "bytes" + "fmt" + "io" + "regexp" + "strconv" + "strings" + "unicode" +) + +const minReaderBufferSize = 4096 + +var pythonMultiline = regexp.MustCompile(`^([\t\f ]+)(.*)`) + +type parserOptions struct { + IgnoreContinuation bool + IgnoreInlineComment bool + AllowPythonMultilineValues bool + SpaceBeforeInlineComment bool + UnescapeValueDoubleQuotes bool + UnescapeValueCommentSymbols bool + PreserveSurroundedQuote bool + DebugFunc DebugFunc + ReaderBufferSize int +} + +type parser struct { + buf *bufio.Reader + options parserOptions + + isEOF bool + count int + comment *bytes.Buffer +} + +func (p *parser) debug(format string, args ...interface{}) { + if p.options.DebugFunc != nil { + p.options.DebugFunc(fmt.Sprintf(format, args...)) + } +} + +func newParser(r io.Reader, opts parserOptions) *parser { + size := opts.ReaderBufferSize + if size < minReaderBufferSize { + size = minReaderBufferSize + } + + return &parser{ + buf: bufio.NewReaderSize(r, size), + options: opts, + count: 1, + comment: &bytes.Buffer{}, + } +} + +// BOM handles header of UTF-8, UTF-16 LE and UTF-16 BE's BOM format. +// http://en.wikipedia.org/wiki/Byte_order_mark#Representations_of_byte_order_marks_by_encoding +func (p *parser) BOM() error { + mask, err := p.buf.Peek(2) + if err != nil && err != io.EOF { + return err + } else if len(mask) < 2 { + return nil + } + + switch { + case mask[0] == 254 && mask[1] == 255: + fallthrough + case mask[0] == 255 && mask[1] == 254: + _, err = p.buf.Read(mask) + if err != nil { + return err + } + case mask[0] == 239 && mask[1] == 187: + mask, err := p.buf.Peek(3) + if err != nil && err != io.EOF { + return err + } else if len(mask) < 3 { + return nil + } + if mask[2] == 191 { + _, err = p.buf.Read(mask) + if err != nil { + return err + } + } + } + return nil +} + +func (p *parser) readUntil(delim byte) ([]byte, error) { + data, err := p.buf.ReadBytes(delim) + if err != nil { + if err == io.EOF { + p.isEOF = true + } else { + return nil, err + } + } + return data, nil +} + +func cleanComment(in []byte) ([]byte, bool) { + i := bytes.IndexAny(in, "#;") + if i == -1 { + return nil, false + } + return in[i:], true +} + +func readKeyName(delimiters string, in []byte) (string, int, error) { + line := string(in) + + // Check if key name surrounded by quotes. + var keyQuote string + if line[0] == '"' { + if len(line) > 6 && line[0:3] == `"""` { + keyQuote = `"""` + } else { + keyQuote = `"` + } + } else if line[0] == '`' { + keyQuote = "`" + } + + // Get out key name + var endIdx int + if len(keyQuote) > 0 { + startIdx := len(keyQuote) + // FIXME: fail case -> """"""name"""=value + pos := strings.Index(line[startIdx:], keyQuote) + if pos == -1 { + return "", -1, fmt.Errorf("missing closing key quote: %s", line) + } + pos += startIdx + + // Find key-value delimiter + i := strings.IndexAny(line[pos+startIdx:], delimiters) + if i < 0 { + return "", -1, ErrDelimiterNotFound{line} + } + endIdx = pos + i + return strings.TrimSpace(line[startIdx:pos]), endIdx + startIdx + 1, nil + } + + endIdx = strings.IndexAny(line, delimiters) + if endIdx < 0 { + return "", -1, ErrDelimiterNotFound{line} + } + if endIdx == 0 { + return "", -1, ErrEmptyKeyName{line} + } + + return strings.TrimSpace(line[0:endIdx]), endIdx + 1, nil +} + +func (p *parser) readMultilines(line, val, valQuote string) (string, error) { + for { + data, err := p.readUntil('\n') + if err != nil { + return "", err + } + next := string(data) + + pos := strings.LastIndex(next, valQuote) + if pos > -1 { + val += next[:pos] + + comment, has := cleanComment([]byte(next[pos:])) + if has { + p.comment.Write(bytes.TrimSpace(comment)) + } + break + } + val += next + if p.isEOF { + return "", fmt.Errorf("missing closing key quote from %q to %q", line, next) + } + } + return val, nil +} + +func (p *parser) readContinuationLines(val string) (string, error) { + for { + data, err := p.readUntil('\n') + if err != nil { + return "", err + } + next := strings.TrimSpace(string(data)) + + if len(next) == 0 { + break + } + val += next + if val[len(val)-1] != '\\' { + break + } + val = val[:len(val)-1] + } + return val, nil +} + +// hasSurroundedQuote check if and only if the first and last characters +// are quotes \" or \'. +// It returns false if any other parts also contain same kind of quotes. +func hasSurroundedQuote(in string, quote byte) bool { + return len(in) >= 2 && in[0] == quote && in[len(in)-1] == quote && + strings.IndexByte(in[1:], quote) == len(in)-2 +} + +func (p *parser) readValue(in []byte, bufferSize int) (string, error) { + + line := strings.TrimLeftFunc(string(in), unicode.IsSpace) + if len(line) == 0 { + if p.options.AllowPythonMultilineValues && len(in) > 0 && in[len(in)-1] == '\n' { + return p.readPythonMultilines(line, bufferSize) + } + return "", nil + } + + var valQuote string + if len(line) > 3 && line[0:3] == `"""` { + valQuote = `"""` + } else if line[0] == '`' { + valQuote = "`" + } else if p.options.UnescapeValueDoubleQuotes && line[0] == '"' { + valQuote = `"` + } + + if len(valQuote) > 0 { + startIdx := len(valQuote) + pos := strings.LastIndex(line[startIdx:], valQuote) + // Check for multi-line value + if pos == -1 { + return p.readMultilines(line, line[startIdx:], valQuote) + } + + if p.options.UnescapeValueDoubleQuotes && valQuote == `"` { + return strings.Replace(line[startIdx:pos+startIdx], `\"`, `"`, -1), nil + } + return line[startIdx : pos+startIdx], nil + } + + lastChar := line[len(line)-1] + // Won't be able to reach here if value only contains whitespace + line = strings.TrimSpace(line) + trimmedLastChar := line[len(line)-1] + + // Check continuation lines when desired + if !p.options.IgnoreContinuation && trimmedLastChar == '\\' { + return p.readContinuationLines(line[:len(line)-1]) + } + + // Check if ignore inline comment + if !p.options.IgnoreInlineComment { + var i int + if p.options.SpaceBeforeInlineComment { + i = strings.Index(line, " #") + if i == -1 { + i = strings.Index(line, " ;") + } + + } else { + i = strings.IndexAny(line, "#;") + } + + if i > -1 { + p.comment.WriteString(line[i:]) + line = strings.TrimSpace(line[:i]) + } + + } + + // Trim single and double quotes + if (hasSurroundedQuote(line, '\'') || + hasSurroundedQuote(line, '"')) && !p.options.PreserveSurroundedQuote { + line = line[1 : len(line)-1] + } else if len(valQuote) == 0 && p.options.UnescapeValueCommentSymbols { + line = strings.ReplaceAll(line, `\;`, ";") + line = strings.ReplaceAll(line, `\#`, "#") + } else if p.options.AllowPythonMultilineValues && lastChar == '\n' { + return p.readPythonMultilines(line, bufferSize) + } + + return line, nil +} + +func (p *parser) readPythonMultilines(line string, bufferSize int) (string, error) { + parserBufferPeekResult, _ := p.buf.Peek(bufferSize) + peekBuffer := bytes.NewBuffer(parserBufferPeekResult) + + for { + peekData, peekErr := peekBuffer.ReadBytes('\n') + if peekErr != nil && peekErr != io.EOF { + p.debug("readPythonMultilines: failed to peek with error: %v", peekErr) + return "", peekErr + } + + p.debug("readPythonMultilines: parsing %q", string(peekData)) + + peekMatches := pythonMultiline.FindStringSubmatch(string(peekData)) + p.debug("readPythonMultilines: matched %d parts", len(peekMatches)) + for n, v := range peekMatches { + p.debug(" %d: %q", n, v) + } + + // Return if not a Python multiline value. + if len(peekMatches) != 3 { + p.debug("readPythonMultilines: end of value, got: %q", line) + return line, nil + } + + // Advance the parser reader (buffer) in-sync with the peek buffer. + _, err := p.buf.Discard(len(peekData)) + if err != nil { + p.debug("readPythonMultilines: failed to skip to the end, returning error") + return "", err + } + + line += "\n" + peekMatches[0] + } +} + +// parse parses data through an io.Reader. +func (f *File) parse(reader io.Reader) (err error) { + p := newParser(reader, parserOptions{ + IgnoreContinuation: f.options.IgnoreContinuation, + IgnoreInlineComment: f.options.IgnoreInlineComment, + AllowPythonMultilineValues: f.options.AllowPythonMultilineValues, + SpaceBeforeInlineComment: f.options.SpaceBeforeInlineComment, + UnescapeValueDoubleQuotes: f.options.UnescapeValueDoubleQuotes, + UnescapeValueCommentSymbols: f.options.UnescapeValueCommentSymbols, + PreserveSurroundedQuote: f.options.PreserveSurroundedQuote, + DebugFunc: f.options.DebugFunc, + ReaderBufferSize: f.options.ReaderBufferSize, + }) + if err = p.BOM(); err != nil { + return fmt.Errorf("BOM: %v", err) + } + + // Ignore error because default section name is never empty string. + name := DefaultSection + if f.options.Insensitive || f.options.InsensitiveSections { + name = strings.ToLower(DefaultSection) + } + section, _ := f.NewSection(name) + + // This "last" is not strictly equivalent to "previous one" if current key is not the first nested key + var isLastValueEmpty bool + var lastRegularKey *Key + + var line []byte + var inUnparseableSection bool + + // NOTE: Iterate and increase `currentPeekSize` until + // the size of the parser buffer is found. + // TODO(unknwon): When Golang 1.10 is the lowest version supported, replace with `parserBufferSize := p.buf.Size()`. + parserBufferSize := 0 + // NOTE: Peek 4kb at a time. + currentPeekSize := minReaderBufferSize + + if f.options.AllowPythonMultilineValues { + for { + peekBytes, _ := p.buf.Peek(currentPeekSize) + peekBytesLength := len(peekBytes) + + if parserBufferSize >= peekBytesLength { + break + } + + currentPeekSize *= 2 + parserBufferSize = peekBytesLength + } + } + + for !p.isEOF { + line, err = p.readUntil('\n') + if err != nil { + return err + } + + if f.options.AllowNestedValues && + isLastValueEmpty && len(line) > 0 { + if line[0] == ' ' || line[0] == '\t' { + err = lastRegularKey.addNestedValue(string(bytes.TrimSpace(line))) + if err != nil { + return err + } + continue + } + } + + line = bytes.TrimLeftFunc(line, unicode.IsSpace) + if len(line) == 0 { + continue + } + + // Comments + if line[0] == '#' || line[0] == ';' { + // Note: we do not care ending line break, + // it is needed for adding second line, + // so just clean it once at the end when set to value. + p.comment.Write(line) + continue + } + + // Section + if line[0] == '[' { + // Read to the next ']' (TODO: support quoted strings) + closeIdx := bytes.LastIndexByte(line, ']') + if closeIdx == -1 { + return fmt.Errorf("unclosed section: %s", line) + } + + name := string(line[1:closeIdx]) + section, err = f.NewSection(name) + if err != nil { + return err + } + + comment, has := cleanComment(line[closeIdx+1:]) + if has { + p.comment.Write(comment) + } + + section.Comment = strings.TrimSpace(p.comment.String()) + + // Reset auto-counter and comments + p.comment.Reset() + p.count = 1 + // Nested values can't span sections + isLastValueEmpty = false + + inUnparseableSection = false + for i := range f.options.UnparseableSections { + if f.options.UnparseableSections[i] == name || + ((f.options.Insensitive || f.options.InsensitiveSections) && strings.EqualFold(f.options.UnparseableSections[i], name)) { + inUnparseableSection = true + continue + } + } + continue + } + + if inUnparseableSection { + section.isRawSection = true + section.rawBody += string(line) + continue + } + + kname, offset, err := readKeyName(f.options.KeyValueDelimiters, line) + if err != nil { + switch { + // Treat as boolean key when desired, and whole line is key name. + case IsErrDelimiterNotFound(err): + switch { + case f.options.AllowBooleanKeys: + kname, err := p.readValue(line, parserBufferSize) + if err != nil { + return err + } + key, err := section.NewBooleanKey(kname) + if err != nil { + return err + } + key.Comment = strings.TrimSpace(p.comment.String()) + p.comment.Reset() + continue + + case f.options.SkipUnrecognizableLines: + continue + } + case IsErrEmptyKeyName(err) && f.options.SkipUnrecognizableLines: + continue + } + return err + } + + // Auto increment. + isAutoIncr := false + if kname == "-" { + isAutoIncr = true + kname = "#" + strconv.Itoa(p.count) + p.count++ + } + + value, err := p.readValue(line[offset:], parserBufferSize) + if err != nil { + return err + } + isLastValueEmpty = len(value) == 0 + + key, err := section.NewKey(kname, value) + if err != nil { + return err + } + key.isAutoIncrement = isAutoIncr + key.Comment = strings.TrimSpace(p.comment.String()) + p.comment.Reset() + lastRegularKey = key + } + return nil +} diff --git a/vendor/github.com/go-ini/ini/section.go b/vendor/github.com/go-ini/ini/section.go new file mode 100644 index 000000000..a3615d820 --- /dev/null +++ b/vendor/github.com/go-ini/ini/section.go @@ -0,0 +1,256 @@ +// Copyright 2014 Unknwon +// +// Licensed under the Apache License, Version 2.0 (the "License"): you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT +// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the +// License for the specific language governing permissions and limitations +// under the License. + +package ini + +import ( + "errors" + "fmt" + "strings" +) + +// Section represents a config section. +type Section struct { + f *File + Comment string + name string + keys map[string]*Key + keyList []string + keysHash map[string]string + + isRawSection bool + rawBody string +} + +func newSection(f *File, name string) *Section { + return &Section{ + f: f, + name: name, + keys: make(map[string]*Key), + keyList: make([]string, 0, 10), + keysHash: make(map[string]string), + } +} + +// Name returns name of Section. +func (s *Section) Name() string { + return s.name +} + +// Body returns rawBody of Section if the section was marked as unparseable. +// It still follows the other rules of the INI format surrounding leading/trailing whitespace. +func (s *Section) Body() string { + return strings.TrimSpace(s.rawBody) +} + +// SetBody updates body content only if section is raw. +func (s *Section) SetBody(body string) { + if !s.isRawSection { + return + } + s.rawBody = body +} + +// NewKey creates a new key to given section. +func (s *Section) NewKey(name, val string) (*Key, error) { + if len(name) == 0 { + return nil, errors.New("error creating new key: empty key name") + } else if s.f.options.Insensitive || s.f.options.InsensitiveKeys { + name = strings.ToLower(name) + } + + if s.f.BlockMode { + s.f.lock.Lock() + defer s.f.lock.Unlock() + } + + if inSlice(name, s.keyList) { + if s.f.options.AllowShadows { + if err := s.keys[name].addShadow(val); err != nil { + return nil, err + } + } else { + s.keys[name].value = val + s.keysHash[name] = val + } + return s.keys[name], nil + } + + s.keyList = append(s.keyList, name) + s.keys[name] = newKey(s, name, val) + s.keysHash[name] = val + return s.keys[name], nil +} + +// NewBooleanKey creates a new boolean type key to given section. +func (s *Section) NewBooleanKey(name string) (*Key, error) { + key, err := s.NewKey(name, "true") + if err != nil { + return nil, err + } + + key.isBooleanType = true + return key, nil +} + +// GetKey returns key in section by given name. +func (s *Section) GetKey(name string) (*Key, error) { + if s.f.BlockMode { + s.f.lock.RLock() + } + if s.f.options.Insensitive || s.f.options.InsensitiveKeys { + name = strings.ToLower(name) + } + key := s.keys[name] + if s.f.BlockMode { + s.f.lock.RUnlock() + } + + if key == nil { + // Check if it is a child-section. + sname := s.name + for { + if i := strings.LastIndex(sname, s.f.options.ChildSectionDelimiter); i > -1 { + sname = sname[:i] + sec, err := s.f.GetSection(sname) + if err != nil { + continue + } + return sec.GetKey(name) + } + break + } + return nil, fmt.Errorf("error when getting key of section %q: key %q not exists", s.name, name) + } + return key, nil +} + +// HasKey returns true if section contains a key with given name. +func (s *Section) HasKey(name string) bool { + key, _ := s.GetKey(name) + return key != nil +} + +// Deprecated: Use "HasKey" instead. +func (s *Section) Haskey(name string) bool { + return s.HasKey(name) +} + +// HasValue returns true if section contains given raw value. +func (s *Section) HasValue(value string) bool { + if s.f.BlockMode { + s.f.lock.RLock() + defer s.f.lock.RUnlock() + } + + for _, k := range s.keys { + if value == k.value { + return true + } + } + return false +} + +// Key assumes named Key exists in section and returns a zero-value when not. +func (s *Section) Key(name string) *Key { + key, err := s.GetKey(name) + if err != nil { + // It's OK here because the only possible error is empty key name, + // but if it's empty, this piece of code won't be executed. + key, _ = s.NewKey(name, "") + return key + } + return key +} + +// Keys returns list of keys of section. +func (s *Section) Keys() []*Key { + keys := make([]*Key, len(s.keyList)) + for i := range s.keyList { + keys[i] = s.Key(s.keyList[i]) + } + return keys +} + +// ParentKeys returns list of keys of parent section. +func (s *Section) ParentKeys() []*Key { + var parentKeys []*Key + sname := s.name + for { + if i := strings.LastIndex(sname, s.f.options.ChildSectionDelimiter); i > -1 { + sname = sname[:i] + sec, err := s.f.GetSection(sname) + if err != nil { + continue + } + parentKeys = append(parentKeys, sec.Keys()...) + } else { + break + } + + } + return parentKeys +} + +// KeyStrings returns list of key names of section. +func (s *Section) KeyStrings() []string { + list := make([]string, len(s.keyList)) + copy(list, s.keyList) + return list +} + +// KeysHash returns keys hash consisting of names and values. +func (s *Section) KeysHash() map[string]string { + if s.f.BlockMode { + s.f.lock.RLock() + defer s.f.lock.RUnlock() + } + + hash := make(map[string]string, len(s.keysHash)) + for key, value := range s.keysHash { + hash[key] = value + } + return hash +} + +// DeleteKey deletes a key from section. +func (s *Section) DeleteKey(name string) { + if s.f.BlockMode { + s.f.lock.Lock() + defer s.f.lock.Unlock() + } + + for i, k := range s.keyList { + if k == name { + s.keyList = append(s.keyList[:i], s.keyList[i+1:]...) + delete(s.keys, name) + delete(s.keysHash, name) + return + } + } +} + +// ChildSections returns a list of child sections of current section. +// For example, "[parent.child1]" and "[parent.child12]" are child sections +// of section "[parent]". +func (s *Section) ChildSections() []*Section { + prefix := s.name + s.f.options.ChildSectionDelimiter + children := make([]*Section, 0, 3) + for _, name := range s.f.sectionList { + if strings.HasPrefix(name, prefix) { + children = append(children, s.f.sections[name]...) + } + } + return children +} diff --git a/vendor/github.com/go-ini/ini/struct.go b/vendor/github.com/go-ini/ini/struct.go new file mode 100644 index 000000000..a486b2fe0 --- /dev/null +++ b/vendor/github.com/go-ini/ini/struct.go @@ -0,0 +1,747 @@ +// Copyright 2014 Unknwon +// +// Licensed under the Apache License, Version 2.0 (the "License"): you may +// not use this file except in compliance with the License. You may obtain +// a copy of the License at +// +// http://www.apache.org/licenses/LICENSE-2.0 +// +// Unless required by applicable law or agreed to in writing, software +// distributed under the License is distributed on an "AS IS" BASIS, WITHOUT +// WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the +// License for the specific language governing permissions and limitations +// under the License. + +package ini + +import ( + "bytes" + "errors" + "fmt" + "reflect" + "strings" + "time" + "unicode" +) + +// NameMapper represents a ini tag name mapper. +type NameMapper func(string) string + +// Built-in name getters. +var ( + // SnackCase converts to format SNACK_CASE. + SnackCase NameMapper = func(raw string) string { + newstr := make([]rune, 0, len(raw)) + for i, chr := range raw { + if isUpper := 'A' <= chr && chr <= 'Z'; isUpper { + if i > 0 { + newstr = append(newstr, '_') + } + } + newstr = append(newstr, unicode.ToUpper(chr)) + } + return string(newstr) + } + // TitleUnderscore converts to format title_underscore. + TitleUnderscore NameMapper = func(raw string) string { + newstr := make([]rune, 0, len(raw)) + for i, chr := range raw { + if isUpper := 'A' <= chr && chr <= 'Z'; isUpper { + if i > 0 { + newstr = append(newstr, '_') + } + chr -= 'A' - 'a' + } + newstr = append(newstr, chr) + } + return string(newstr) + } +) + +func (s *Section) parseFieldName(raw, actual string) string { + if len(actual) > 0 { + return actual + } + if s.f.NameMapper != nil { + return s.f.NameMapper(raw) + } + return raw +} + +func parseDelim(actual string) string { + if len(actual) > 0 { + return actual + } + return "," +} + +var reflectTime = reflect.TypeOf(time.Now()).Kind() + +// setSliceWithProperType sets proper values to slice based on its type. +func setSliceWithProperType(key *Key, field reflect.Value, delim string, allowShadow, isStrict bool) error { + var strs []string + if allowShadow { + strs = key.StringsWithShadows(delim) + } else { + strs = key.Strings(delim) + } + + numVals := len(strs) + if numVals == 0 { + return nil + } + + var vals interface{} + var err error + + sliceOf := field.Type().Elem().Kind() + switch sliceOf { + case reflect.String: + vals = strs + case reflect.Int: + vals, err = key.parseInts(strs, true, false) + case reflect.Int64: + vals, err = key.parseInt64s(strs, true, false) + case reflect.Uint: + vals, err = key.parseUints(strs, true, false) + case reflect.Uint64: + vals, err = key.parseUint64s(strs, true, false) + case reflect.Float64: + vals, err = key.parseFloat64s(strs, true, false) + case reflect.Bool: + vals, err = key.parseBools(strs, true, false) + case reflectTime: + vals, err = key.parseTimesFormat(time.RFC3339, strs, true, false) + default: + return fmt.Errorf("unsupported type '[]%s'", sliceOf) + } + if err != nil && isStrict { + return err + } + + slice := reflect.MakeSlice(field.Type(), numVals, numVals) + for i := 0; i < numVals; i++ { + switch sliceOf { + case reflect.String: + slice.Index(i).Set(reflect.ValueOf(vals.([]string)[i])) + case reflect.Int: + slice.Index(i).Set(reflect.ValueOf(vals.([]int)[i])) + case reflect.Int64: + slice.Index(i).Set(reflect.ValueOf(vals.([]int64)[i])) + case reflect.Uint: + slice.Index(i).Set(reflect.ValueOf(vals.([]uint)[i])) + case reflect.Uint64: + slice.Index(i).Set(reflect.ValueOf(vals.([]uint64)[i])) + case reflect.Float64: + slice.Index(i).Set(reflect.ValueOf(vals.([]float64)[i])) + case reflect.Bool: + slice.Index(i).Set(reflect.ValueOf(vals.([]bool)[i])) + case reflectTime: + slice.Index(i).Set(reflect.ValueOf(vals.([]time.Time)[i])) + } + } + field.Set(slice) + return nil +} + +func wrapStrictError(err error, isStrict bool) error { + if isStrict { + return err + } + return nil +} + +// setWithProperType sets proper value to field based on its type, +// but it does not return error for failing parsing, +// because we want to use default value that is already assigned to struct. +func setWithProperType(t reflect.Type, key *Key, field reflect.Value, delim string, allowShadow, isStrict bool) error { + vt := t + isPtr := t.Kind() == reflect.Ptr + if isPtr { + vt = t.Elem() + } + switch vt.Kind() { + case reflect.String: + stringVal := key.String() + if isPtr { + field.Set(reflect.ValueOf(&stringVal)) + } else if len(stringVal) > 0 { + field.SetString(key.String()) + } + case reflect.Bool: + boolVal, err := key.Bool() + if err != nil { + return wrapStrictError(err, isStrict) + } + if isPtr { + field.Set(reflect.ValueOf(&boolVal)) + } else { + field.SetBool(boolVal) + } + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + // ParseDuration will not return err for `0`, so check the type name + if vt.Name() == "Duration" { + durationVal, err := key.Duration() + if err != nil { + if intVal, err := key.Int64(); err == nil { + field.SetInt(intVal) + return nil + } + return wrapStrictError(err, isStrict) + } + if isPtr { + field.Set(reflect.ValueOf(&durationVal)) + } else if int64(durationVal) > 0 { + field.Set(reflect.ValueOf(durationVal)) + } + return nil + } + + intVal, err := key.Int64() + if err != nil { + return wrapStrictError(err, isStrict) + } + if isPtr { + pv := reflect.New(t.Elem()) + pv.Elem().SetInt(intVal) + field.Set(pv) + } else { + field.SetInt(intVal) + } + // byte is an alias for uint8, so supporting uint8 breaks support for byte + case reflect.Uint, reflect.Uint16, reflect.Uint32, reflect.Uint64: + durationVal, err := key.Duration() + // Skip zero value + if err == nil && uint64(durationVal) > 0 { + if isPtr { + field.Set(reflect.ValueOf(&durationVal)) + } else { + field.Set(reflect.ValueOf(durationVal)) + } + return nil + } + + uintVal, err := key.Uint64() + if err != nil { + return wrapStrictError(err, isStrict) + } + if isPtr { + pv := reflect.New(t.Elem()) + pv.Elem().SetUint(uintVal) + field.Set(pv) + } else { + field.SetUint(uintVal) + } + + case reflect.Float32, reflect.Float64: + floatVal, err := key.Float64() + if err != nil { + return wrapStrictError(err, isStrict) + } + if isPtr { + pv := reflect.New(t.Elem()) + pv.Elem().SetFloat(floatVal) + field.Set(pv) + } else { + field.SetFloat(floatVal) + } + case reflectTime: + timeVal, err := key.Time() + if err != nil { + return wrapStrictError(err, isStrict) + } + if isPtr { + field.Set(reflect.ValueOf(&timeVal)) + } else { + field.Set(reflect.ValueOf(timeVal)) + } + case reflect.Slice: + return setSliceWithProperType(key, field, delim, allowShadow, isStrict) + default: + return fmt.Errorf("unsupported type %q", t) + } + return nil +} + +func parseTagOptions(tag string) (rawName string, omitEmpty bool, allowShadow bool, allowNonUnique bool, extends bool) { + opts := strings.SplitN(tag, ",", 5) + rawName = opts[0] + for _, opt := range opts[1:] { + omitEmpty = omitEmpty || (opt == "omitempty") + allowShadow = allowShadow || (opt == "allowshadow") + allowNonUnique = allowNonUnique || (opt == "nonunique") + extends = extends || (opt == "extends") + } + return rawName, omitEmpty, allowShadow, allowNonUnique, extends +} + +// mapToField maps the given value to the matching field of the given section. +// The sectionIndex is the index (if non unique sections are enabled) to which the value should be added. +func (s *Section) mapToField(val reflect.Value, isStrict bool, sectionIndex int, sectionName string) error { + if val.Kind() == reflect.Ptr { + val = val.Elem() + } + typ := val.Type() + + for i := 0; i < typ.NumField(); i++ { + field := val.Field(i) + tpField := typ.Field(i) + + tag := tpField.Tag.Get("ini") + if tag == "-" { + continue + } + + rawName, _, allowShadow, allowNonUnique, extends := parseTagOptions(tag) + fieldName := s.parseFieldName(tpField.Name, rawName) + if len(fieldName) == 0 || !field.CanSet() { + continue + } + + isStruct := tpField.Type.Kind() == reflect.Struct + isStructPtr := tpField.Type.Kind() == reflect.Ptr && tpField.Type.Elem().Kind() == reflect.Struct + isAnonymousPtr := tpField.Type.Kind() == reflect.Ptr && tpField.Anonymous + if isAnonymousPtr { + field.Set(reflect.New(tpField.Type.Elem())) + } + + if extends && (isAnonymousPtr || (isStruct && tpField.Anonymous)) { + if isStructPtr && field.IsNil() { + field.Set(reflect.New(tpField.Type.Elem())) + } + fieldSection := s + if rawName != "" { + sectionName = s.name + s.f.options.ChildSectionDelimiter + rawName + if secs, err := s.f.SectionsByName(sectionName); err == nil && sectionIndex < len(secs) { + fieldSection = secs[sectionIndex] + } + } + if err := fieldSection.mapToField(field, isStrict, sectionIndex, sectionName); err != nil { + return fmt.Errorf("map to field %q: %v", fieldName, err) + } + } else if isAnonymousPtr || isStruct || isStructPtr { + if secs, err := s.f.SectionsByName(fieldName); err == nil { + if len(secs) <= sectionIndex { + return fmt.Errorf("there are not enough sections (%d <= %d) for the field %q", len(secs), sectionIndex, fieldName) + } + // Only set the field to non-nil struct value if we have a section for it. + // Otherwise, we end up with a non-nil struct ptr even though there is no data. + if isStructPtr && field.IsNil() { + field.Set(reflect.New(tpField.Type.Elem())) + } + if err = secs[sectionIndex].mapToField(field, isStrict, sectionIndex, fieldName); err != nil { + return fmt.Errorf("map to field %q: %v", fieldName, err) + } + continue + } + } + + // Map non-unique sections + if allowNonUnique && tpField.Type.Kind() == reflect.Slice { + newField, err := s.mapToSlice(fieldName, field, isStrict) + if err != nil { + return fmt.Errorf("map to slice %q: %v", fieldName, err) + } + + field.Set(newField) + continue + } + + if key, err := s.GetKey(fieldName); err == nil { + delim := parseDelim(tpField.Tag.Get("delim")) + if err = setWithProperType(tpField.Type, key, field, delim, allowShadow, isStrict); err != nil { + return fmt.Errorf("set field %q: %v", fieldName, err) + } + } + } + return nil +} + +// mapToSlice maps all sections with the same name and returns the new value. +// The type of the Value must be a slice. +func (s *Section) mapToSlice(secName string, val reflect.Value, isStrict bool) (reflect.Value, error) { + secs, err := s.f.SectionsByName(secName) + if err != nil { + return reflect.Value{}, err + } + + typ := val.Type().Elem() + for i, sec := range secs { + elem := reflect.New(typ) + if err = sec.mapToField(elem, isStrict, i, sec.name); err != nil { + return reflect.Value{}, fmt.Errorf("map to field from section %q: %v", secName, err) + } + + val = reflect.Append(val, elem.Elem()) + } + return val, nil +} + +// mapTo maps a section to object v. +func (s *Section) mapTo(v interface{}, isStrict bool) error { + typ := reflect.TypeOf(v) + val := reflect.ValueOf(v) + if typ.Kind() == reflect.Ptr { + typ = typ.Elem() + val = val.Elem() + } else { + return errors.New("not a pointer to a struct") + } + + if typ.Kind() == reflect.Slice { + newField, err := s.mapToSlice(s.name, val, isStrict) + if err != nil { + return err + } + + val.Set(newField) + return nil + } + + return s.mapToField(val, isStrict, 0, s.name) +} + +// MapTo maps section to given struct. +func (s *Section) MapTo(v interface{}) error { + return s.mapTo(v, false) +} + +// StrictMapTo maps section to given struct in strict mode, +// which returns all possible error including value parsing error. +func (s *Section) StrictMapTo(v interface{}) error { + return s.mapTo(v, true) +} + +// MapTo maps file to given struct. +func (f *File) MapTo(v interface{}) error { + return f.Section("").MapTo(v) +} + +// StrictMapTo maps file to given struct in strict mode, +// which returns all possible error including value parsing error. +func (f *File) StrictMapTo(v interface{}) error { + return f.Section("").StrictMapTo(v) +} + +// MapToWithMapper maps data sources to given struct with name mapper. +func MapToWithMapper(v interface{}, mapper NameMapper, source interface{}, others ...interface{}) error { + cfg, err := Load(source, others...) + if err != nil { + return err + } + cfg.NameMapper = mapper + return cfg.MapTo(v) +} + +// StrictMapToWithMapper maps data sources to given struct with name mapper in strict mode, +// which returns all possible error including value parsing error. +func StrictMapToWithMapper(v interface{}, mapper NameMapper, source interface{}, others ...interface{}) error { + cfg, err := Load(source, others...) + if err != nil { + return err + } + cfg.NameMapper = mapper + return cfg.StrictMapTo(v) +} + +// MapTo maps data sources to given struct. +func MapTo(v, source interface{}, others ...interface{}) error { + return MapToWithMapper(v, nil, source, others...) +} + +// StrictMapTo maps data sources to given struct in strict mode, +// which returns all possible error including value parsing error. +func StrictMapTo(v, source interface{}, others ...interface{}) error { + return StrictMapToWithMapper(v, nil, source, others...) +} + +// reflectSliceWithProperType does the opposite thing as setSliceWithProperType. +func reflectSliceWithProperType(key *Key, field reflect.Value, delim string, allowShadow bool) error { + slice := field.Slice(0, field.Len()) + if field.Len() == 0 { + return nil + } + sliceOf := field.Type().Elem().Kind() + + if allowShadow { + var keyWithShadows *Key + for i := 0; i < field.Len(); i++ { + var val string + switch sliceOf { + case reflect.String: + val = slice.Index(i).String() + case reflect.Int, reflect.Int64: + val = fmt.Sprint(slice.Index(i).Int()) + case reflect.Uint, reflect.Uint64: + val = fmt.Sprint(slice.Index(i).Uint()) + case reflect.Float64: + val = fmt.Sprint(slice.Index(i).Float()) + case reflect.Bool: + val = fmt.Sprint(slice.Index(i).Bool()) + case reflectTime: + val = slice.Index(i).Interface().(time.Time).Format(time.RFC3339) + default: + return fmt.Errorf("unsupported type '[]%s'", sliceOf) + } + + if i == 0 { + keyWithShadows = newKey(key.s, key.name, val) + } else { + _ = keyWithShadows.AddShadow(val) + } + } + *key = *keyWithShadows + return nil + } + + var buf bytes.Buffer + for i := 0; i < field.Len(); i++ { + switch sliceOf { + case reflect.String: + buf.WriteString(slice.Index(i).String()) + case reflect.Int, reflect.Int64: + buf.WriteString(fmt.Sprint(slice.Index(i).Int())) + case reflect.Uint, reflect.Uint64: + buf.WriteString(fmt.Sprint(slice.Index(i).Uint())) + case reflect.Float64: + buf.WriteString(fmt.Sprint(slice.Index(i).Float())) + case reflect.Bool: + buf.WriteString(fmt.Sprint(slice.Index(i).Bool())) + case reflectTime: + buf.WriteString(slice.Index(i).Interface().(time.Time).Format(time.RFC3339)) + default: + return fmt.Errorf("unsupported type '[]%s'", sliceOf) + } + buf.WriteString(delim) + } + key.SetValue(buf.String()[:buf.Len()-len(delim)]) + return nil +} + +// reflectWithProperType does the opposite thing as setWithProperType. +func reflectWithProperType(t reflect.Type, key *Key, field reflect.Value, delim string, allowShadow bool) error { + switch t.Kind() { + case reflect.String: + key.SetValue(field.String()) + case reflect.Bool: + key.SetValue(fmt.Sprint(field.Bool())) + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + key.SetValue(fmt.Sprint(field.Int())) + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64: + key.SetValue(fmt.Sprint(field.Uint())) + case reflect.Float32, reflect.Float64: + key.SetValue(fmt.Sprint(field.Float())) + case reflectTime: + key.SetValue(fmt.Sprint(field.Interface().(time.Time).Format(time.RFC3339))) + case reflect.Slice: + return reflectSliceWithProperType(key, field, delim, allowShadow) + case reflect.Ptr: + if !field.IsNil() { + return reflectWithProperType(t.Elem(), key, field.Elem(), delim, allowShadow) + } + default: + return fmt.Errorf("unsupported type %q", t) + } + return nil +} + +// CR: copied from encoding/json/encode.go with modifications of time.Time support. +// TODO: add more test coverage. +func isEmptyValue(v reflect.Value) bool { + switch v.Kind() { + case reflect.Array, reflect.Map, reflect.Slice, reflect.String: + return v.Len() == 0 + case reflect.Bool: + return !v.Bool() + case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: + return v.Int() == 0 + case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: + return v.Uint() == 0 + case reflect.Float32, reflect.Float64: + return v.Float() == 0 + case reflect.Interface, reflect.Ptr: + return v.IsNil() + case reflectTime: + t, ok := v.Interface().(time.Time) + return ok && t.IsZero() + } + return false +} + +// StructReflector is the interface implemented by struct types that can extract themselves into INI objects. +type StructReflector interface { + ReflectINIStruct(*File) error +} + +func (s *Section) reflectFrom(val reflect.Value) error { + if val.Kind() == reflect.Ptr { + val = val.Elem() + } + typ := val.Type() + + for i := 0; i < typ.NumField(); i++ { + if !val.Field(i).CanInterface() { + continue + } + + field := val.Field(i) + tpField := typ.Field(i) + + tag := tpField.Tag.Get("ini") + if tag == "-" { + continue + } + + rawName, omitEmpty, allowShadow, allowNonUnique, extends := parseTagOptions(tag) + if omitEmpty && isEmptyValue(field) { + continue + } + + if r, ok := field.Interface().(StructReflector); ok { + return r.ReflectINIStruct(s.f) + } + + fieldName := s.parseFieldName(tpField.Name, rawName) + if len(fieldName) == 0 || !field.CanSet() { + continue + } + + if extends && tpField.Anonymous && (tpField.Type.Kind() == reflect.Ptr || tpField.Type.Kind() == reflect.Struct) { + if err := s.reflectFrom(field); err != nil { + return fmt.Errorf("reflect from field %q: %v", fieldName, err) + } + continue + } + + if (tpField.Type.Kind() == reflect.Ptr && tpField.Type.Elem().Kind() == reflect.Struct) || + (tpField.Type.Kind() == reflect.Struct && tpField.Type.Name() != "Time") { + // Note: The only error here is section doesn't exist. + sec, err := s.f.GetSection(fieldName) + if err != nil { + // Note: fieldName can never be empty here, ignore error. + sec, _ = s.f.NewSection(fieldName) + } + + // Add comment from comment tag + if len(sec.Comment) == 0 { + sec.Comment = tpField.Tag.Get("comment") + } + + if err = sec.reflectFrom(field); err != nil { + return fmt.Errorf("reflect from field %q: %v", fieldName, err) + } + continue + } + + if allowNonUnique && tpField.Type.Kind() == reflect.Slice { + slice := field.Slice(0, field.Len()) + if field.Len() == 0 { + return nil + } + sliceOf := field.Type().Elem().Kind() + + for i := 0; i < field.Len(); i++ { + if sliceOf != reflect.Struct && sliceOf != reflect.Ptr { + return fmt.Errorf("field %q is not a slice of pointer or struct", fieldName) + } + + sec, err := s.f.NewSection(fieldName) + if err != nil { + return err + } + + // Add comment from comment tag + if len(sec.Comment) == 0 { + sec.Comment = tpField.Tag.Get("comment") + } + + if err := sec.reflectFrom(slice.Index(i)); err != nil { + return fmt.Errorf("reflect from field %q: %v", fieldName, err) + } + } + continue + } + + // Note: Same reason as section. + key, err := s.GetKey(fieldName) + if err != nil { + key, _ = s.NewKey(fieldName, "") + } + + // Add comment from comment tag + if len(key.Comment) == 0 { + key.Comment = tpField.Tag.Get("comment") + } + + delim := parseDelim(tpField.Tag.Get("delim")) + if err = reflectWithProperType(tpField.Type, key, field, delim, allowShadow); err != nil { + return fmt.Errorf("reflect field %q: %v", fieldName, err) + } + + } + return nil +} + +// ReflectFrom reflects section from given struct. It overwrites existing ones. +func (s *Section) ReflectFrom(v interface{}) error { + typ := reflect.TypeOf(v) + val := reflect.ValueOf(v) + + if s.name != DefaultSection && s.f.options.AllowNonUniqueSections && + (typ.Kind() == reflect.Slice || typ.Kind() == reflect.Ptr) { + // Clear sections to make sure none exists before adding the new ones + s.f.DeleteSection(s.name) + + if typ.Kind() == reflect.Ptr { + sec, err := s.f.NewSection(s.name) + if err != nil { + return err + } + return sec.reflectFrom(val.Elem()) + } + + slice := val.Slice(0, val.Len()) + sliceOf := val.Type().Elem().Kind() + if sliceOf != reflect.Ptr { + return fmt.Errorf("not a slice of pointers") + } + + for i := 0; i < slice.Len(); i++ { + sec, err := s.f.NewSection(s.name) + if err != nil { + return err + } + + err = sec.reflectFrom(slice.Index(i)) + if err != nil { + return fmt.Errorf("reflect from %dth field: %v", i, err) + } + } + + return nil + } + + if typ.Kind() == reflect.Ptr { + val = val.Elem() + } else { + return errors.New("not a pointer to a struct") + } + + return s.reflectFrom(val) +} + +// ReflectFrom reflects file from given struct. +func (f *File) ReflectFrom(v interface{}) error { + return f.Section("").ReflectFrom(v) +} + +// ReflectFromWithMapper reflects data sources from given struct with name mapper. +func ReflectFromWithMapper(cfg *File, v interface{}, mapper NameMapper) error { + cfg.NameMapper = mapper + return cfg.ReflectFrom(v) +} + +// ReflectFrom reflects data sources from given struct. +func ReflectFrom(cfg *File, v interface{}) error { + return ReflectFromWithMapper(cfg, v, nil) +} diff --git a/vendor/github.com/goccy/go-json/.golangci.yml b/vendor/github.com/goccy/go-json/.golangci.yml index 57ae5a528..977accaa9 100644 --- a/vendor/github.com/goccy/go-json/.golangci.yml +++ b/vendor/github.com/goccy/go-json/.golangci.yml @@ -56,6 +56,9 @@ linters: - cyclop - containedctx - revive + - nosnakecase + - exhaustruct + - depguard issues: exclude-rules: diff --git a/vendor/github.com/goccy/go-json/Makefile b/vendor/github.com/goccy/go-json/Makefile index 5bbfc4c9a..c030577dc 100644 --- a/vendor/github.com/goccy/go-json/Makefile +++ b/vendor/github.com/goccy/go-json/Makefile @@ -30,7 +30,7 @@ golangci-lint: | $(BIN_DIR) GOLANGCI_LINT_TMP_DIR=$$(mktemp -d); \ cd $$GOLANGCI_LINT_TMP_DIR; \ go mod init tmp; \ - GOBIN=$(BIN_DIR) go install github.com/golangci/golangci-lint/cmd/golangci-lint@v1.48.0; \ + GOBIN=$(BIN_DIR) go install github.com/golangci/golangci-lint/cmd/golangci-lint@v1.54.2; \ rm -rf $$GOLANGCI_LINT_TMP_DIR; \ } diff --git a/vendor/github.com/goccy/go-json/encode.go b/vendor/github.com/goccy/go-json/encode.go index 4bd899f38..c5173825a 100644 --- a/vendor/github.com/goccy/go-json/encode.go +++ b/vendor/github.com/goccy/go-json/encode.go @@ -52,7 +52,7 @@ func (e *Encoder) EncodeContext(ctx context.Context, v interface{}, optFuncs ... rctx.Option.Flag |= encoder.ContextOption rctx.Option.Context = ctx - err := e.encodeWithOption(rctx, v, optFuncs...) + err := e.encodeWithOption(rctx, v, optFuncs...) //nolint: contextcheck encoder.ReleaseRuntimeContext(rctx) return err @@ -120,7 +120,7 @@ func marshalContext(ctx context.Context, v interface{}, optFuncs ...EncodeOption optFunc(rctx.Option) } - buf, err := encode(rctx, v) + buf, err := encode(rctx, v) //nolint: contextcheck if err != nil { encoder.ReleaseRuntimeContext(rctx) return nil, err diff --git a/vendor/github.com/goccy/go-json/internal/decoder/ptr.go b/vendor/github.com/goccy/go-json/internal/decoder/ptr.go index de12e105c..ae2299466 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/ptr.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/ptr.go @@ -85,6 +85,7 @@ func (d *ptrDecoder) Decode(ctx *RuntimeContext, cursor, depth int64, p unsafe.P } c, err := d.dec.Decode(ctx, cursor, depth, newptr) if err != nil { + *(*unsafe.Pointer)(p) = nil return 0, err } cursor = c diff --git a/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_text.go b/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_text.go index 6d37993f0..d711d0f85 100644 --- a/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_text.go +++ b/vendor/github.com/goccy/go-json/internal/decoder/unmarshal_text.go @@ -147,7 +147,7 @@ func (d *unmarshalTextDecoder) DecodePath(ctx *RuntimeContext, cursor, depth int return nil, 0, fmt.Errorf("json: unmarshal text decoder does not support decode path") } -func unquoteBytes(s []byte) (t []byte, ok bool) { +func unquoteBytes(s []byte) (t []byte, ok bool) { //nolint: nonamedreturns length := len(s) if length < 2 || s[0] != '"' || s[length-1] != '"' { return diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compact.go b/vendor/github.com/goccy/go-json/internal/encoder/compact.go index 0eb9545d8..e287a6c03 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compact.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compact.go @@ -213,8 +213,8 @@ func compactString(dst, src []byte, cursor int64, escape bool) ([]byte, int64, e dst = append(dst, src[start:cursor]...) dst = append(dst, `\u202`...) dst = append(dst, hex[src[cursor+2]&0xF]) - cursor += 2 start = cursor + 3 + cursor += 2 } } switch c { diff --git a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go index 3ae39ba8c..37b7aa38e 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/compiler.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/compiler.go @@ -480,7 +480,7 @@ func (c *Compiler) mapCode(typ *runtime.Type) (*MapCode, error) { func (c *Compiler) listElemCode(typ *runtime.Type) (Code, error) { switch { - case c.isPtrMarshalJSONType(typ): + case c.implementsMarshalJSONType(typ) || c.implementsMarshalJSONType(runtime.PtrTo(typ)): return c.marshalJSONCode(typ) case !typ.Implements(marshalTextType) && runtime.PtrTo(typ).Implements(marshalTextType): return c.marshalTextCode(typ) diff --git a/vendor/github.com/goccy/go-json/internal/encoder/int.go b/vendor/github.com/goccy/go-json/internal/encoder/int.go index 85f079609..8b5febeaa 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/int.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/int.go @@ -1,3 +1,27 @@ +// This files's processing codes are inspired by https://github.com/segmentio/encoding. +// The license notation is as follows. +// +// # MIT License +// +// Copyright (c) 2019 Segment.io, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in all +// copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +// SOFTWARE. package encoder import ( diff --git a/vendor/github.com/goccy/go-json/internal/encoder/string.go b/vendor/github.com/goccy/go-json/internal/encoder/string.go index e4152b27c..4abb84165 100644 --- a/vendor/github.com/goccy/go-json/internal/encoder/string.go +++ b/vendor/github.com/goccy/go-json/internal/encoder/string.go @@ -1,3 +1,27 @@ +// This files's string processing codes are inspired by https://github.com/segmentio/encoding. +// The license notation is as follows. +// +// # MIT License +// +// Copyright (c) 2019 Segment.io, Inc. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in all +// copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +// SOFTWARE. package encoder import ( diff --git a/vendor/github.com/goccy/go-json/internal/runtime/rtype.go b/vendor/github.com/goccy/go-json/internal/runtime/rtype.go index 4db10debe..37cfe35a1 100644 --- a/vendor/github.com/goccy/go-json/internal/runtime/rtype.go +++ b/vendor/github.com/goccy/go-json/internal/runtime/rtype.go @@ -252,7 +252,6 @@ func IfaceIndir(*Type) bool //go:noescape func RType2Type(t *Type) reflect.Type -//go:nolint structcheck type emptyInterface struct { _ *Type ptr unsafe.Pointer diff --git a/vendor/github.com/goccy/go-json/json.go b/vendor/github.com/goccy/go-json/json.go index 413cb20bf..fb18065a2 100644 --- a/vendor/github.com/goccy/go-json/json.go +++ b/vendor/github.com/goccy/go-json/json.go @@ -89,31 +89,31 @@ type UnmarshalerContext interface { // // Examples of struct field tags and their meanings: // -// // Field appears in JSON as key "myName". -// Field int `json:"myName"` +// // Field appears in JSON as key "myName". +// Field int `json:"myName"` // -// // Field appears in JSON as key "myName" and -// // the field is omitted from the object if its value is empty, -// // as defined above. -// Field int `json:"myName,omitempty"` +// // Field appears in JSON as key "myName" and +// // the field is omitted from the object if its value is empty, +// // as defined above. +// Field int `json:"myName,omitempty"` // -// // Field appears in JSON as key "Field" (the default), but -// // the field is skipped if empty. -// // Note the leading comma. -// Field int `json:",omitempty"` +// // Field appears in JSON as key "Field" (the default), but +// // the field is skipped if empty. +// // Note the leading comma. +// Field int `json:",omitempty"` // -// // Field is ignored by this package. -// Field int `json:"-"` +// // Field is ignored by this package. +// Field int `json:"-"` // -// // Field appears in JSON as key "-". -// Field int `json:"-,"` +// // Field appears in JSON as key "-". +// Field int `json:"-,"` // // The "string" option signals that a field is stored as JSON inside a // JSON-encoded string. It applies only to fields of string, floating point, // integer, or boolean types. This extra level of encoding is sometimes used // when communicating with JavaScript programs: // -// Int64String int64 `json:",string"` +// Int64String int64 `json:",string"` // // The key name will be used if it's a non-empty string consisting of // only Unicode letters, digits, and ASCII punctuation except quotation @@ -166,7 +166,6 @@ type UnmarshalerContext interface { // JSON cannot represent cyclic data structures and Marshal does not // handle them. Passing cyclic structures to Marshal will result in // an infinite recursion. -// func Marshal(v interface{}) ([]byte, error) { return MarshalWithOption(v) } @@ -264,14 +263,13 @@ func MarshalIndentWithOption(v interface{}, prefix, indent string, optFuncs ...E // // The JSON null value unmarshals into an interface, map, pointer, or slice // by setting that Go value to nil. Because null is often used in JSON to mean -// ``not present,'' unmarshaling a JSON null into any other Go type has no effect +// “not present,” unmarshaling a JSON null into any other Go type has no effect // on the value and produces no error. // // When unmarshaling quoted strings, invalid UTF-8 or // invalid UTF-16 surrogate pairs are not treated as an error. // Instead, they are replaced by the Unicode replacement // character U+FFFD. -// func Unmarshal(data []byte, v interface{}) error { return unmarshal(data, v) } @@ -299,7 +297,6 @@ func UnmarshalNoEscape(data []byte, v interface{}, optFuncs ...DecodeOptionFunc) // Number, for JSON numbers // string, for JSON string literals // nil, for JSON null -// type Token = json.Token // A Number represents a JSON number literal. diff --git a/vendor/github.com/klauspost/compress/s2/decode_arm64.s b/vendor/github.com/klauspost/compress/s2/decode_arm64.s index 4b63d5086..78e463f34 100644 --- a/vendor/github.com/klauspost/compress/s2/decode_arm64.s +++ b/vendor/github.com/klauspost/compress/s2/decode_arm64.s @@ -60,7 +60,7 @@ // // The d variable is implicitly R_DST - R_DBASE, and len(dst)-d is R_DEND - R_DST. // The s variable is implicitly R_SRC - R_SBASE, and len(src)-s is R_SEND - R_SRC. -TEXT ·s2Decode(SB), NOSPLIT, $56-64 +TEXT ·s2Decode(SB), NOSPLIT, $56-56 // Initialize R_SRC, R_DST and R_DBASE-R_SEND. MOVD dst_base+0(FP), R_DBASE MOVD dst_len+8(FP), R_DLEN diff --git a/vendor/github.com/klauspost/compress/s2/index.go b/vendor/github.com/klauspost/compress/s2/index.go index 18a4f7acd..4229957b9 100644 --- a/vendor/github.com/klauspost/compress/s2/index.go +++ b/vendor/github.com/klauspost/compress/s2/index.go @@ -17,6 +17,8 @@ const ( S2IndexHeader = "s2idx\x00" S2IndexTrailer = "\x00xdi2s" maxIndexEntries = 1 << 16 + // If distance is less than this, we do not add the entry. + minIndexDist = 1 << 20 ) // Index represents an S2/Snappy index. @@ -72,6 +74,10 @@ func (i *Index) add(compressedOffset, uncompressedOffset int64) error { if latest.compressedOffset > compressedOffset { return fmt.Errorf("internal error: Earlier compressed received (%d > %d)", latest.uncompressedOffset, uncompressedOffset) } + if latest.uncompressedOffset+minIndexDist > uncompressedOffset { + // Only add entry if distance is large enough. + return nil + } } i.info = append(i.info, struct { compressedOffset int64 @@ -122,7 +128,7 @@ func (i *Index) Find(offset int64) (compressedOff, uncompressedOff int64, err er // reduce to stay below maxIndexEntries func (i *Index) reduce() { - if len(i.info) < maxIndexEntries && i.estBlockUncomp >= 1<<20 { + if len(i.info) < maxIndexEntries && i.estBlockUncomp >= minIndexDist { return } @@ -132,7 +138,7 @@ func (i *Index) reduce() { j := 0 // Each block should be at least 1MB, but don't reduce below 1000 entries. - for i.estBlockUncomp*(int64(removeN)+1) < 1<<20 && len(i.info)/(removeN+1) > 1000 { + for i.estBlockUncomp*(int64(removeN)+1) < minIndexDist && len(i.info)/(removeN+1) > 1000 { removeN++ } for idx := 0; idx < len(src); idx++ { diff --git a/vendor/github.com/klauspost/compress/s2/s2.go b/vendor/github.com/klauspost/compress/s2/s2.go index 72bcb4945..cbd1ed64d 100644 --- a/vendor/github.com/klauspost/compress/s2/s2.go +++ b/vendor/github.com/klauspost/compress/s2/s2.go @@ -109,7 +109,11 @@ const ( chunkTypeStreamIdentifier = 0xff ) -var crcTable = crc32.MakeTable(crc32.Castagnoli) +var ( + crcTable = crc32.MakeTable(crc32.Castagnoli) + magicChunkSnappyBytes = []byte(magicChunkSnappy) // Can be passed to functions where it escapes. + magicChunkBytes = []byte(magicChunk) // Can be passed to functions where it escapes. +) // crc implements the checksum specified in section 3 of // https://github.com/google/snappy/blob/master/framing_format.txt diff --git a/vendor/github.com/klauspost/compress/s2/writer.go b/vendor/github.com/klauspost/compress/s2/writer.go index 637c93147..0a46f2b98 100644 --- a/vendor/github.com/klauspost/compress/s2/writer.go +++ b/vendor/github.com/klauspost/compress/s2/writer.go @@ -239,6 +239,9 @@ func (w *Writer) ReadFrom(r io.Reader) (n int64, err error) { } } if n2 == 0 { + if cap(inbuf) >= w.obufLen { + w.buffers.Put(inbuf) + } break } n += int64(n2) @@ -314,9 +317,9 @@ func (w *Writer) AddSkippableBlock(id uint8, data []byte) (err error) { hWriter := make(chan result) w.output <- hWriter if w.snappy { - hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunkSnappy)} + hWriter <- result{startOffset: w.uncompWritten, b: magicChunkSnappyBytes} } else { - hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunk)} + hWriter <- result{startOffset: w.uncompWritten, b: magicChunkBytes} } } @@ -370,9 +373,9 @@ func (w *Writer) EncodeBuffer(buf []byte) (err error) { hWriter := make(chan result) w.output <- hWriter if w.snappy { - hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunkSnappy)} + hWriter <- result{startOffset: w.uncompWritten, b: magicChunkSnappyBytes} } else { - hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunk)} + hWriter <- result{startOffset: w.uncompWritten, b: magicChunkBytes} } } @@ -478,9 +481,9 @@ func (w *Writer) write(p []byte) (nRet int, errRet error) { hWriter := make(chan result) w.output <- hWriter if w.snappy { - hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunkSnappy)} + hWriter <- result{startOffset: w.uncompWritten, b: magicChunkSnappyBytes} } else { - hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunk)} + hWriter <- result{startOffset: w.uncompWritten, b: magicChunkBytes} } } @@ -560,6 +563,9 @@ func (w *Writer) writeFull(inbuf []byte) (errRet error) { if w.concurrency == 1 { _, err := w.writeSync(inbuf[obufHeaderLen:]) + if cap(inbuf) >= w.obufLen { + w.buffers.Put(inbuf) + } return err } @@ -569,9 +575,9 @@ func (w *Writer) writeFull(inbuf []byte) (errRet error) { hWriter := make(chan result) w.output <- hWriter if w.snappy { - hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunkSnappy)} + hWriter <- result{startOffset: w.uncompWritten, b: magicChunkSnappyBytes} } else { - hWriter <- result{startOffset: w.uncompWritten, b: []byte(magicChunk)} + hWriter <- result{startOffset: w.uncompWritten, b: magicChunkBytes} } } @@ -637,9 +643,9 @@ func (w *Writer) writeSync(p []byte) (nRet int, errRet error) { var n int var err error if w.snappy { - n, err = w.writer.Write([]byte(magicChunkSnappy)) + n, err = w.writer.Write(magicChunkSnappyBytes) } else { - n, err = w.writer.Write([]byte(magicChunk)) + n, err = w.writer.Write(magicChunkBytes) } if err != nil { return 0, w.err(err) diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index 30f8d2963..21508edbd 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -310,6 +310,7 @@ Exit Code 1 | AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one | | AVXVNNI | AVX (VEX encoded) VNNI neural network instructions | | AVXVNNIINT8 | AVX-VNNI-INT8 instructions | +| AVXVNNIINT16 | AVX-VNNI-INT16 instructions | | BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 | | BMI1 | Bit Manipulation Instruction Set 1 | | BMI2 | Bit Manipulation Instruction Set 2 | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index 805f5e7b4..53bc18ca7 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -104,6 +104,7 @@ const ( AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one AVXVNNI // AVX (VEX encoded) VNNI neural network instructions AVXVNNIINT8 // AVX-VNNI-INT8 instructions + AVXVNNIINT16 // AVX-VNNI-INT16 instructions BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 BMI1 // Bit Manipulation Instruction Set 1 BMI2 // Bit Manipulation Instruction Set 2 @@ -1242,6 +1243,7 @@ func support() flagSet { // CPUID.(EAX=7, ECX=1).EDX fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) + fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16) fs.setIf(edx1&(1<<14) != 0, PREFETCHI) fs.setIf(edx1&(1<<19) != 0, AVX10) fs.setIf(edx1&(1<<21) != 0, APX_F) diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 57a085a53..3a2560310 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -44,194 +44,195 @@ func _() { _ = x[AVXSLOW-34] _ = x[AVXVNNI-35] _ = x[AVXVNNIINT8-36] - _ = x[BHI_CTRL-37] - _ = x[BMI1-38] - _ = x[BMI2-39] - _ = x[CETIBT-40] - _ = x[CETSS-41] - _ = x[CLDEMOTE-42] - _ = x[CLMUL-43] - _ = x[CLZERO-44] - _ = x[CMOV-45] - _ = x[CMPCCXADD-46] - _ = x[CMPSB_SCADBS_SHORT-47] - _ = x[CMPXCHG8-48] - _ = x[CPBOOST-49] - _ = x[CPPC-50] - _ = x[CX16-51] - _ = x[EFER_LMSLE_UNS-52] - _ = x[ENQCMD-53] - _ = x[ERMS-54] - _ = x[F16C-55] - _ = x[FLUSH_L1D-56] - _ = x[FMA3-57] - _ = x[FMA4-58] - _ = x[FP128-59] - _ = x[FP256-60] - _ = x[FSRM-61] - _ = x[FXSR-62] - _ = x[FXSROPT-63] - _ = x[GFNI-64] - _ = x[HLE-65] - _ = x[HRESET-66] - _ = x[HTT-67] - _ = x[HWA-68] - _ = x[HYBRID_CPU-69] - _ = x[HYPERVISOR-70] - _ = x[IA32_ARCH_CAP-71] - _ = x[IA32_CORE_CAP-72] - _ = x[IBPB-73] - _ = x[IBPB_BRTYPE-74] - _ = x[IBRS-75] - _ = x[IBRS_PREFERRED-76] - _ = x[IBRS_PROVIDES_SMP-77] - _ = x[IBS-78] - _ = x[IBSBRNTRGT-79] - _ = x[IBSFETCHSAM-80] - _ = x[IBSFFV-81] - _ = x[IBSOPCNT-82] - _ = x[IBSOPCNTEXT-83] - _ = x[IBSOPSAM-84] - _ = x[IBSRDWROPCNT-85] - _ = x[IBSRIPINVALIDCHK-86] - _ = x[IBS_FETCH_CTLX-87] - _ = x[IBS_OPDATA4-88] - _ = x[IBS_OPFUSE-89] - _ = x[IBS_PREVENTHOST-90] - _ = x[IBS_ZEN4-91] - _ = x[IDPRED_CTRL-92] - _ = x[INT_WBINVD-93] - _ = x[INVLPGB-94] - _ = x[KEYLOCKER-95] - _ = x[KEYLOCKERW-96] - _ = x[LAHF-97] - _ = x[LAM-98] - _ = x[LBRVIRT-99] - _ = x[LZCNT-100] - _ = x[MCAOVERFLOW-101] - _ = x[MCDT_NO-102] - _ = x[MCOMMIT-103] - _ = x[MD_CLEAR-104] - _ = x[MMX-105] - _ = x[MMXEXT-106] - _ = x[MOVBE-107] - _ = x[MOVDIR64B-108] - _ = x[MOVDIRI-109] - _ = x[MOVSB_ZL-110] - _ = x[MOVU-111] - _ = x[MPX-112] - _ = x[MSRIRC-113] - _ = x[MSRLIST-114] - _ = x[MSR_PAGEFLUSH-115] - _ = x[NRIPS-116] - _ = x[NX-117] - _ = x[OSXSAVE-118] - _ = x[PCONFIG-119] - _ = x[POPCNT-120] - _ = x[PPIN-121] - _ = x[PREFETCHI-122] - _ = x[PSFD-123] - _ = x[RDPRU-124] - _ = x[RDRAND-125] - _ = x[RDSEED-126] - _ = x[RDTSCP-127] - _ = x[RRSBA_CTRL-128] - _ = x[RTM-129] - _ = x[RTM_ALWAYS_ABORT-130] - _ = x[SBPB-131] - _ = x[SERIALIZE-132] - _ = x[SEV-133] - _ = x[SEV_64BIT-134] - _ = x[SEV_ALTERNATIVE-135] - _ = x[SEV_DEBUGSWAP-136] - _ = x[SEV_ES-137] - _ = x[SEV_RESTRICTED-138] - _ = x[SEV_SNP-139] - _ = x[SGX-140] - _ = x[SGXLC-141] - _ = x[SHA-142] - _ = x[SME-143] - _ = x[SME_COHERENT-144] - _ = x[SPEC_CTRL_SSBD-145] - _ = x[SRBDS_CTRL-146] - _ = x[SRSO_MSR_FIX-147] - _ = x[SRSO_NO-148] - _ = x[SRSO_USER_KERNEL_NO-149] - _ = x[SSE-150] - _ = x[SSE2-151] - _ = x[SSE3-152] - _ = x[SSE4-153] - _ = x[SSE42-154] - _ = x[SSE4A-155] - _ = x[SSSE3-156] - _ = x[STIBP-157] - _ = x[STIBP_ALWAYSON-158] - _ = x[STOSB_SHORT-159] - _ = x[SUCCOR-160] - _ = x[SVM-161] - _ = x[SVMDA-162] - _ = x[SVMFBASID-163] - _ = x[SVML-164] - _ = x[SVMNP-165] - _ = x[SVMPF-166] - _ = x[SVMPFT-167] - _ = x[SYSCALL-168] - _ = x[SYSEE-169] - _ = x[TBM-170] - _ = x[TDX_GUEST-171] - _ = x[TLB_FLUSH_NESTED-172] - _ = x[TME-173] - _ = x[TOPEXT-174] - _ = x[TSCRATEMSR-175] - _ = x[TSXLDTRK-176] - _ = x[VAES-177] - _ = x[VMCBCLEAN-178] - _ = x[VMPL-179] - _ = x[VMSA_REGPROT-180] - _ = x[VMX-181] - _ = x[VPCLMULQDQ-182] - _ = x[VTE-183] - _ = x[WAITPKG-184] - _ = x[WBNOINVD-185] - _ = x[WRMSRNS-186] - _ = x[X87-187] - _ = x[XGETBV1-188] - _ = x[XOP-189] - _ = x[XSAVE-190] - _ = x[XSAVEC-191] - _ = x[XSAVEOPT-192] - _ = x[XSAVES-193] - _ = x[AESARM-194] - _ = x[ARMCPUID-195] - _ = x[ASIMD-196] - _ = x[ASIMDDP-197] - _ = x[ASIMDHP-198] - _ = x[ASIMDRDM-199] - _ = x[ATOMICS-200] - _ = x[CRC32-201] - _ = x[DCPOP-202] - _ = x[EVTSTRM-203] - _ = x[FCMA-204] - _ = x[FP-205] - _ = x[FPHP-206] - _ = x[GPA-207] - _ = x[JSCVT-208] - _ = x[LRCPC-209] - _ = x[PMULL-210] - _ = x[SHA1-211] - _ = x[SHA2-212] - _ = x[SHA3-213] - _ = x[SHA512-214] - _ = x[SM3-215] - _ = x[SM4-216] - _ = x[SVE-217] - _ = x[lastID-218] + _ = x[AVXVNNIINT16-37] + _ = x[BHI_CTRL-38] + _ = x[BMI1-39] + _ = x[BMI2-40] + _ = x[CETIBT-41] + _ = x[CETSS-42] + _ = x[CLDEMOTE-43] + _ = x[CLMUL-44] + _ = x[CLZERO-45] + _ = x[CMOV-46] + _ = x[CMPCCXADD-47] + _ = x[CMPSB_SCADBS_SHORT-48] + _ = x[CMPXCHG8-49] + _ = x[CPBOOST-50] + _ = x[CPPC-51] + _ = x[CX16-52] + _ = x[EFER_LMSLE_UNS-53] + _ = x[ENQCMD-54] + _ = x[ERMS-55] + _ = x[F16C-56] + _ = x[FLUSH_L1D-57] + _ = x[FMA3-58] + _ = x[FMA4-59] + _ = x[FP128-60] + _ = x[FP256-61] + _ = x[FSRM-62] + _ = x[FXSR-63] + _ = x[FXSROPT-64] + _ = x[GFNI-65] + _ = x[HLE-66] + _ = x[HRESET-67] + _ = x[HTT-68] + _ = x[HWA-69] + _ = x[HYBRID_CPU-70] + _ = x[HYPERVISOR-71] + _ = x[IA32_ARCH_CAP-72] + _ = x[IA32_CORE_CAP-73] + _ = x[IBPB-74] + _ = x[IBPB_BRTYPE-75] + _ = x[IBRS-76] + _ = x[IBRS_PREFERRED-77] + _ = x[IBRS_PROVIDES_SMP-78] + _ = x[IBS-79] + _ = x[IBSBRNTRGT-80] + _ = x[IBSFETCHSAM-81] + _ = x[IBSFFV-82] + _ = x[IBSOPCNT-83] + _ = x[IBSOPCNTEXT-84] + _ = x[IBSOPSAM-85] + _ = x[IBSRDWROPCNT-86] + _ = x[IBSRIPINVALIDCHK-87] + _ = x[IBS_FETCH_CTLX-88] + _ = x[IBS_OPDATA4-89] + _ = x[IBS_OPFUSE-90] + _ = x[IBS_PREVENTHOST-91] + _ = x[IBS_ZEN4-92] + _ = x[IDPRED_CTRL-93] + _ = x[INT_WBINVD-94] + _ = x[INVLPGB-95] + _ = x[KEYLOCKER-96] + _ = x[KEYLOCKERW-97] + _ = x[LAHF-98] + _ = x[LAM-99] + _ = x[LBRVIRT-100] + _ = x[LZCNT-101] + _ = x[MCAOVERFLOW-102] + _ = x[MCDT_NO-103] + _ = x[MCOMMIT-104] + _ = x[MD_CLEAR-105] + _ = x[MMX-106] + _ = x[MMXEXT-107] + _ = x[MOVBE-108] + _ = x[MOVDIR64B-109] + _ = x[MOVDIRI-110] + _ = x[MOVSB_ZL-111] + _ = x[MOVU-112] + _ = x[MPX-113] + _ = x[MSRIRC-114] + _ = x[MSRLIST-115] + _ = x[MSR_PAGEFLUSH-116] + _ = x[NRIPS-117] + _ = x[NX-118] + _ = x[OSXSAVE-119] + _ = x[PCONFIG-120] + _ = x[POPCNT-121] + _ = x[PPIN-122] + _ = x[PREFETCHI-123] + _ = x[PSFD-124] + _ = x[RDPRU-125] + _ = x[RDRAND-126] + _ = x[RDSEED-127] + _ = x[RDTSCP-128] + _ = x[RRSBA_CTRL-129] + _ = x[RTM-130] + _ = x[RTM_ALWAYS_ABORT-131] + _ = x[SBPB-132] + _ = x[SERIALIZE-133] + _ = x[SEV-134] + _ = x[SEV_64BIT-135] + _ = x[SEV_ALTERNATIVE-136] + _ = x[SEV_DEBUGSWAP-137] + _ = x[SEV_ES-138] + _ = x[SEV_RESTRICTED-139] + _ = x[SEV_SNP-140] + _ = x[SGX-141] + _ = x[SGXLC-142] + _ = x[SHA-143] + _ = x[SME-144] + _ = x[SME_COHERENT-145] + _ = x[SPEC_CTRL_SSBD-146] + _ = x[SRBDS_CTRL-147] + _ = x[SRSO_MSR_FIX-148] + _ = x[SRSO_NO-149] + _ = x[SRSO_USER_KERNEL_NO-150] + _ = x[SSE-151] + _ = x[SSE2-152] + _ = x[SSE3-153] + _ = x[SSE4-154] + _ = x[SSE42-155] + _ = x[SSE4A-156] + _ = x[SSSE3-157] + _ = x[STIBP-158] + _ = x[STIBP_ALWAYSON-159] + _ = x[STOSB_SHORT-160] + _ = x[SUCCOR-161] + _ = x[SVM-162] + _ = x[SVMDA-163] + _ = x[SVMFBASID-164] + _ = x[SVML-165] + _ = x[SVMNP-166] + _ = x[SVMPF-167] + _ = x[SVMPFT-168] + _ = x[SYSCALL-169] + _ = x[SYSEE-170] + _ = x[TBM-171] + _ = x[TDX_GUEST-172] + _ = x[TLB_FLUSH_NESTED-173] + _ = x[TME-174] + _ = x[TOPEXT-175] + _ = x[TSCRATEMSR-176] + _ = x[TSXLDTRK-177] + _ = x[VAES-178] + _ = x[VMCBCLEAN-179] + _ = x[VMPL-180] + _ = x[VMSA_REGPROT-181] + _ = x[VMX-182] + _ = x[VPCLMULQDQ-183] + _ = x[VTE-184] + _ = x[WAITPKG-185] + _ = x[WBNOINVD-186] + _ = x[WRMSRNS-187] + _ = x[X87-188] + _ = x[XGETBV1-189] + _ = x[XOP-190] + _ = x[XSAVE-191] + _ = x[XSAVEC-192] + _ = x[XSAVEOPT-193] + _ = x[XSAVES-194] + _ = x[AESARM-195] + _ = x[ARMCPUID-196] + _ = x[ASIMD-197] + _ = x[ASIMDDP-198] + _ = x[ASIMDHP-199] + _ = x[ASIMDRDM-200] + _ = x[ATOMICS-201] + _ = x[CRC32-202] + _ = x[DCPOP-203] + _ = x[EVTSTRM-204] + _ = x[FCMA-205] + _ = x[FP-206] + _ = x[FPHP-207] + _ = x[GPA-208] + _ = x[JSCVT-209] + _ = x[LRCPC-210] + _ = x[PMULL-211] + _ = x[SHA1-212] + _ = x[SHA2-213] + _ = x[SHA3-214] + _ = x[SHA512-215] + _ = x[SM3-216] + _ = x[SM4-217] + _ = x[SVE-218] + _ = x[lastID-219] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 319, 323, 327, 333, 338, 346, 351, 357, 361, 370, 388, 396, 403, 407, 411, 425, 431, 435, 439, 448, 452, 456, 461, 466, 470, 474, 481, 485, 488, 494, 497, 500, 510, 520, 533, 546, 550, 561, 565, 579, 596, 599, 609, 620, 626, 634, 645, 653, 665, 681, 695, 706, 716, 731, 739, 750, 760, 767, 776, 786, 790, 793, 800, 805, 816, 823, 830, 838, 841, 847, 852, 861, 868, 876, 880, 883, 889, 896, 909, 914, 916, 923, 930, 936, 940, 949, 953, 958, 964, 970, 976, 986, 989, 1005, 1009, 1018, 1021, 1030, 1045, 1058, 1064, 1078, 1085, 1088, 1093, 1096, 1099, 1111, 1125, 1135, 1147, 1154, 1173, 1176, 1180, 1184, 1188, 1193, 1198, 1203, 1208, 1222, 1233, 1239, 1242, 1247, 1256, 1260, 1265, 1270, 1276, 1283, 1288, 1291, 1300, 1316, 1319, 1325, 1335, 1343, 1347, 1356, 1360, 1372, 1375, 1385, 1388, 1395, 1403, 1410, 1413, 1420, 1423, 1428, 1434, 1442, 1448, 1454, 1462, 1467, 1474, 1481, 1489, 1496, 1501, 1506, 1513, 1517, 1519, 1523, 1526, 1531, 1536, 1541, 1545, 1549, 1553, 1559, 1562, 1565, 1568, 1574} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 323, 331, 335, 339, 345, 350, 358, 363, 369, 373, 382, 400, 408, 415, 419, 423, 437, 443, 447, 451, 460, 464, 468, 473, 478, 482, 486, 493, 497, 500, 506, 509, 512, 522, 532, 545, 558, 562, 573, 577, 591, 608, 611, 621, 632, 638, 646, 657, 665, 677, 693, 707, 718, 728, 743, 751, 762, 772, 779, 788, 798, 802, 805, 812, 817, 828, 835, 842, 850, 853, 859, 864, 873, 880, 888, 892, 895, 901, 908, 921, 926, 928, 935, 942, 948, 952, 961, 965, 970, 976, 982, 988, 998, 1001, 1017, 1021, 1030, 1033, 1042, 1057, 1070, 1076, 1090, 1097, 1100, 1105, 1108, 1111, 1123, 1137, 1147, 1159, 1166, 1185, 1188, 1192, 1196, 1200, 1205, 1210, 1215, 1220, 1234, 1245, 1251, 1254, 1259, 1268, 1272, 1277, 1282, 1288, 1295, 1300, 1303, 1312, 1328, 1331, 1337, 1347, 1355, 1359, 1368, 1372, 1384, 1387, 1397, 1400, 1407, 1415, 1422, 1425, 1432, 1435, 1440, 1446, 1454, 1460, 1466, 1474, 1479, 1486, 1493, 1501, 1508, 1513, 1518, 1525, 1529, 1531, 1535, 1538, 1543, 1548, 1553, 1557, 1561, 1565, 1571, 1574, 1577, 1580, 1586} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go b/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go index 9182d4eac..51226630d 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object-streaming.go @@ -637,7 +637,9 @@ func (c *Client) putObjectMultipartStreamParallel(ctx context.Context, bucketNam // Sort all completed parts. sort.Sort(completedParts(complMultipartUpload.Parts)) - opts = PutObjectOptions{} + opts = PutObjectOptions{ + ServerSideEncryption: opts.ServerSideEncryption, + } if len(crcBytes) > 0 { // Add hash of hashes. crc.Reset() diff --git a/vendor/github.com/minio/minio-go/v7/api-put-object.go b/vendor/github.com/minio/minio-go/v7/api-put-object.go index a96de9b9f..6ccb58156 100644 --- a/vendor/github.com/minio/minio-go/v7/api-put-object.go +++ b/vendor/github.com/minio/minio-go/v7/api-put-object.go @@ -464,7 +464,9 @@ func (c *Client) putObjectMultipartStreamNoLength(ctx context.Context, bucketNam // Sort all completed parts. sort.Sort(completedParts(complMultipartUpload.Parts)) - opts = PutObjectOptions{} + opts = PutObjectOptions{ + ServerSideEncryption: opts.ServerSideEncryption, + } if len(crcBytes) > 0 { // Add hash of hashes. crc.Reset() diff --git a/vendor/github.com/minio/minio-go/v7/api.go b/vendor/github.com/minio/minio-go/v7/api.go index eaaaa68c2..602722782 100644 --- a/vendor/github.com/minio/minio-go/v7/api.go +++ b/vendor/github.com/minio/minio-go/v7/api.go @@ -129,7 +129,7 @@ type Options struct { // Global constants. const ( libraryName = "minio-go" - libraryVersion = "v7.0.72" + libraryVersion = "v7.0.73" ) // User Agent should always following the below style. diff --git a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go index 8c5c4eb2d..541e1a72f 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/credentials/file_aws_credentials.go @@ -26,7 +26,7 @@ import ( "strings" "time" - ini "gopkg.in/ini.v1" + "github.com/go-ini/ini" ) // A externalProcessCredentials stores the output of a credential_process diff --git a/vendor/github.com/minio/minio-go/v7/pkg/replication/replication.go b/vendor/github.com/minio/minio-go/v7/pkg/replication/replication.go index 0abbf6efc..65a2f75e9 100644 --- a/vendor/github.com/minio/minio-go/v7/pkg/replication/replication.go +++ b/vendor/github.com/minio/minio-go/v7/pkg/replication/replication.go @@ -406,6 +406,9 @@ func (c *Config) EditRule(opts Options) error { return fmt.Errorf("priority must be unique. Replication configuration already has a rule with this priority") } if rule.Destination.Bucket != newRule.Destination.Bucket && rule.ID == newRule.ID { + if c.Role == newRule.Destination.Bucket { + continue + } return fmt.Errorf("invalid destination bucket for this rule") } } diff --git a/vendor/github.com/minio/minio-go/v7/s3-endpoints.go b/vendor/github.com/minio/minio-go/v7/s3-endpoints.go index 068a6bfa1..01cee8a19 100644 --- a/vendor/github.com/minio/minio-go/v7/s3-endpoints.go +++ b/vendor/github.com/minio/minio-go/v7/s3-endpoints.go @@ -44,6 +44,10 @@ var awsS3EndpointMap = map[string]awsS3Endpoint{ "s3.ca-central-1.amazonaws.com", "s3.dualstack.ca-central-1.amazonaws.com", }, + "ca-west-1": { + "s3.ca-west-1.amazonaws.com", + "s3.dualstack.ca-west-1.amazonaws.com", + }, "eu-west-1": { "s3.eu-west-1.amazonaws.com", "s3.dualstack.eu-west-1.amazonaws.com", diff --git a/vendor/modules.txt b/vendor/modules.txt index 028bae6a5..a001cb3d7 100644 --- a/vendor/modules.txt +++ b/vendor/modules.txt @@ -238,6 +238,9 @@ github.com/go-errors/errors # github.com/go-fed/httpsig v1.1.0 ## explicit; go 1.13 github.com/go-fed/httpsig +# github.com/go-ini/ini v1.67.0 +## explicit +github.com/go-ini/ini # github.com/go-jose/go-jose/v4 v4.0.1 ## explicit; go 1.21 github.com/go-jose/go-jose/v4 @@ -322,8 +325,8 @@ github.com/go-swagger/go-swagger/generator # github.com/go-xmlfmt/xmlfmt v0.0.0-20211206191508-7fd73a941850 ## explicit github.com/go-xmlfmt/xmlfmt -# github.com/goccy/go-json v0.10.2 -## explicit; go 1.12 +# github.com/goccy/go-json v0.10.3 +## explicit; go 1.19 github.com/goccy/go-json github.com/goccy/go-json/internal/decoder github.com/goccy/go-json/internal/encoder @@ -450,11 +453,11 @@ github.com/josharian/intern # github.com/json-iterator/go v1.1.12 ## explicit; go 1.12 github.com/json-iterator/go -# github.com/klauspost/compress v1.17.8 +# github.com/klauspost/compress v1.17.9 ## explicit; go 1.20 github.com/klauspost/compress/internal/race github.com/klauspost/compress/s2 -# github.com/klauspost/cpuid/v2 v2.2.7 +# github.com/klauspost/cpuid/v2 v2.2.8 ## explicit; go 1.15 github.com/klauspost/cpuid/v2 # github.com/kr/pretty v0.3.1 @@ -488,7 +491,7 @@ github.com/miekg/dns # github.com/minio/md5-simd v1.1.2 ## explicit; go 1.14 github.com/minio/md5-simd -# github.com/minio/minio-go/v7 v7.0.72 +# github.com/minio/minio-go/v7 v7.0.73 ## explicit; go 1.21 github.com/minio/minio-go/v7 github.com/minio/minio-go/v7/pkg/credentials